Equus przewalskii (Przewalski's horse): 103564491 Help Entry 103564491         CDS       T04644                                  Symbol H2AL3 Name (RefSeq) histone H2A-like 3   KO K11251   histone H2A Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz03082   ATP-dependent chromatin remodeling epz04217   Necroptosis epz04613   Neutrophil extracellular trap formation epz05034   Alcoholism epz05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:epz00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     103564491 (H2AL3)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103564491 (H2AL3)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103564491 (H2AL3)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     103564491 (H2AL3)   09165 Substance dependence    05034 Alcoholism     103564491 (H2AL3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:epz03036]     103564491 (H2AL3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:epz04147]     103564491 (H2AL3) Chromosome and associated proteins [BR:epz03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103564491 (H2AL3) Exosome [BR:epz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103564491 (H2AL3) SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Histone_ABTB Cdc6_lid Motif Other DBs NCBI-GeneID:  103564491 NCBI-ProteinID:  XP_008538514 UniProt:  A0ABM2FLP7 LinkDB All DBs Position X:31075724..31076300 Genome browser AA seq 117 aa AA seqDB search MSGRRNRQLSFRRRKHTQSRSTRAELQFPVSRVDRLLRQGAYGQRLSSSTPIFLAGILEY LTANILELASKEAHSSRKIRITPEHVQRAVENNQHLSHLFENETYRQSDQMPQPSKK NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgtctgggaggagaaatcgccagctgtcttttaggcgtaggaagcacacccagtcccgc tctacaagagccgagctgcagtttcctgttagccgtgtggaccgcctcctgcgacagggt gcgtatggccagcgcctgagctcgtcgacacctattttcctcgctggtattcttgaatac ctgacagccaacatcctggagctggcaagcaaggaggcccacagcagccgcaagatacgc atcaccccagaacacgtgcagagggcagtggagaataaccagcacctcagccacctcttt gagaatgagacctaccgtcagagtgatcagatgccgcaacccagtaagaagtga

DBGET integrated database retrieval system