Equus przewalskii (Przewalski's horse): 103565440 Help Entry 103565440         CDS       T04644                                  Name (RefSeq) histone H2A type 1-H   KO K11251   histone H2A Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz03082   ATP-dependent chromatin remodeling epz04217   Necroptosis epz04613   Neutrophil extracellular trap formation epz05034   Alcoholism epz05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:epz00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     103565440  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103565440  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103565440  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     103565440   09165 Substance dependence    05034 Alcoholism     103565440  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:epz03036]     103565440   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:epz04147]     103565440 Chromosome and associated proteins [BR:epz03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103565440 Exosome [BR:epz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103565440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  103565440 NCBI-ProteinID:  XP_008539710 UniProt:  A0ABM2FMS5 LinkDB All DBs Position 19:26866243..26866742 Genome browser AA seq 128 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHHKAK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgaggcaagcagggcggcaaagctcgcgccaaggccaagacccgctcttct cgggccgggctgcagttccccgtgggccgagtgcaccgcctgctccgcaagggcaactac gccgagcgggtcggggccggcgcgccggtgtacctggcggcggtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcaaa gtgaccatcgcgcagggcggtgtgctgcccaacatccaggccgtgctgctgcccaagaag accgagagccaccacaaggccaagtaa

DBGET integrated database retrieval system