Equus przewalskii (Przewalski's horse): 103565451 Help Entry 103565451         CDS       T04644                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04613   Neutrophil extracellular trap formation epz05034   Alcoholism epz05202   Transcriptional misregulation in cancer epz05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:epz00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103565451  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     103565451   09163 Immune disease    05322 Systemic lupus erythematosus     103565451   09165 Substance dependence    05034 Alcoholism     103565451  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:epz03036]     103565451   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:epz04147]     103565451 Chromosome and associated proteins [BR:epz03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103565451 Exosome [BR:epz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103565451 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  103565451 NCBI-ProteinID:  XP_008539720 UniProt:  A0ABM4LIV4 LinkDB All DBs Position 19:complement(26917437..26917903) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacaaagcagacagctcgcaagtccaccggcggcaaggcgccccgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtgaagaagccccac cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgcaagctgcccttccagcgcctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctcgcgcgccgcatccgcggagaaagagcttaa

DBGET integrated database retrieval system