Equus przewalskii (Przewalski's horse): 103565483 Help Entry 103565483         CDS       T04644                                  Symbol H2AJ Name (RefSeq) histone H2A.J   KO K11251   histone H2A Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz03082   ATP-dependent chromatin remodeling epz04217   Necroptosis epz04613   Neutrophil extracellular trap formation epz05034   Alcoholism epz05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:epz00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     103565483 (H2AJ)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103565483 (H2AJ)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103565483 (H2AJ)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     103565483 (H2AJ)   09165 Substance dependence    05034 Alcoholism     103565483 (H2AJ)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:epz03036]     103565483 (H2AJ)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:epz04147]     103565483 (H2AJ) Chromosome and associated proteins [BR:epz03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103565483 (H2AJ) Exosome [BR:epz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103565483 (H2AJ) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  103565483 NCBI-ProteinID:  XP_008539759 UniProt:  A0ABM2FI95 LinkDB All DBs Position 5:43383200..43384077 Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESQKAKSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggaaagcagggcggcaaagtgcgggcaaaggccaagtcacggtcctcc cgcgcgggcctgcagttcccagtgggccgagtgcacagactgctgcgcaaaggtaattac gcggagcgagtaggcgctggggcgccggtgtacctggcagcggtgttggagtacctgacg gcggagatcctggagttggctggcaacgccgctcgtgacaacaagaagaccaggataatc cctcgccacctgcaactcgccatccgcaacgacgaggagctaaacaagctgctggggaaa gtgaccatcgctcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag acggagagtcagaaggcgaagagcaagtga

DBGET integrated database retrieval system