Equus przewalskii (Przewalski's horse): 103566767 Help Entry 103566767         CDS       T04644                                  Symbol CXCL6 Name (RefSeq) C-X-C motif chemokine 6   KO K05506   C-X-C motif chemokine 5/6 Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04060   Cytokine-cytokine receptor interaction epz04061   Viral protein interaction with cytokine and cytokine receptor epz04062   Chemokine signaling pathway epz04657   IL-17 signaling pathway epz04668   TNF signaling pathway epz05133   Pertussis epz05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:epz00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     103566767 (CXCL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103566767 (CXCL6)    04061 Viral protein interaction with cytokine and cytokine receptor     103566767 (CXCL6)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     103566767 (CXCL6)    04062 Chemokine signaling pathway     103566767 (CXCL6)  09160 Human Diseases   09171 Infectious disease: bacterial    05133 Pertussis     103566767 (CXCL6)   09163 Immune disease    05323 Rheumatoid arthritis     103566767 (CXCL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:epz04052]     103566767 (CXCL6) Cytokines and neuropeptides [BR:epz04052]  Cytokines   Chemokines    103566767 (CXCL6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  103566767 NCBI-ProteinID:  XP_070468880 LinkDB All DBs Position 3:complement(61727799..61730058) Genome browser AA seq 113 aa AA seqDB search MSLLPSRAARVPGPSSSLCALLALLLLTPPGPLVSAGPVAAAVRELRCMCLTVTPGIHPK MISSLQVFAVGPQCSKVEVVATLKNKKEVCLDPEAPLIKKFIQKTLDSGNKKN NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgagcctcttgcccagccgcgccgcccgcgtccccggcccttcaagctcgctgtgcgcg ctgctcgcgctgctgctgctgacgcctcccgggccccttgtcagcgctggtcctgtcgcg gccgcagtgagagaactgcgttgcatgtgtttaaccgtcacacctgggattcatcccaaa atgatcagtagtctgcaagtgttcgccgtgggtccccagtgctccaaggtggaagtcgta gccaccttgaagaacaagaaggaagtctgtctggacccagaagcccctttgatcaagaaa ttcatccagaaaacgttggacagtggaaacaagaaaaattga

DBGET integrated database retrieval system