Equus przewalskii (Przewalski's horse): 139073278 Help Entry 139073278         CDS       T04644                                  Name (RefSeq) histone H2B type 1-M   KO K11252   histone H2B Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04613   Neutrophil extracellular trap formation epz05034   Alcoholism epz05203   Viral carcinogenesis epz05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:epz00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     139073278  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     139073278   09163 Immune disease    05322 Systemic lupus erythematosus     139073278   09165 Substance dependence    05034 Alcoholism     139073278  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:epz03036]     139073278   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:epz04147]     139073278 Chromosome and associated proteins [BR:epz03036]  Eukaryotic type   Nucleosome assembly factors    Histones     139073278 Exosome [BR:epz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    139073278 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  139073278 NCBI-ProteinID:  XP_008539392 LinkDB All DBs Position 19:24356759..24365034 Genome browser AA seq 126 aa AA seqDB search MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaacctactaagtcggctccagccccgaagaagggctccaagaaagcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtc tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacctccagggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgctgtgtcggagggcaccaaggccgtcacc aagtacaccagctccaagtaa

DBGET integrated database retrieval system