Equus przewalskii (Przewalski's horse): 139077283 Help Entry 139077283         CDS       T04644                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04613   Neutrophil extracellular trap formation epz05034   Alcoholism epz05202   Transcriptional misregulation in cancer epz05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:epz00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     139077283  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     139077283   09163 Immune disease    05322 Systemic lupus erythematosus     139077283   09165 Substance dependence    05034 Alcoholism     139077283  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:epz03036]     139077283   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:epz04147]     139077283 Chromosome and associated proteins [BR:epz03036]  Eukaryotic type   Nucleosome assembly factors    Histones     139077283 Exosome [BR:epz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    139077283 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  139077283 NCBI-ProteinID:  XP_070440347 UniProt:  A0ABM4LIV4 LinkDB All DBs Position 19:24256724..24258949 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtactaagcagacagctcgcaagtccaccggcggcaaggcgccgcgcaagcag ctggccaccaaggcggctcgcaagagcgcgccggccacgggcggcgtgaagaagccccac cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgtaagctgcccttccagcgcctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctctttgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctcgcgcgccgcatccgtggggaaagagcataa

DBGET integrated database retrieval system