Equus przewalskii (Przewalski's horse): 139077434 Help Entry 139077434         CDS       T04644                                  Name (RefSeq) histone H2A type 1   KO K11251   histone H2A Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz03082   ATP-dependent chromatin remodeling epz04217   Necroptosis epz04613   Neutrophil extracellular trap formation epz05034   Alcoholism epz05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:epz00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     139077434  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     139077434  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     139077434  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     139077434   09165 Substance dependence    05034 Alcoholism     139077434  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:epz03036]     139077434   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:epz04147]     139077434 Chromosome and associated proteins [BR:epz03036]  Eukaryotic type   Nucleosome assembly factors    Histones     139077434 Exosome [BR:epz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    139077434 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  139077434 NCBI-ProteinID:  XP_070441457 UniProt:  A0ABM4LLX0 LinkDB All DBs Position 19:complement(26929438..26929885) Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgaggcaagcagggcggcaaagctcgcgccaaggccaagacccgctcttct cgggccgggctgcagttccccgtgggccgagtgcaccgcctgctccgcaagggcaactac gccgagcgggtcggggccggcgcgccggtgtacctggcggcggtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcaaa gtgaccatcgcgcagggtggtgtgctgcccaacatccaggccgtgctgctgcccaagaag accgagagtcatcacaaagccaagggcaagtaa

DBGET integrated database retrieval system