Equus przewalskii (Przewalski's horse): 139078534 Help Entry 139078534         CDS       T04644                                  Name (RefSeq) interferon alpha-3   KO K05414   interferon alpha Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04060   Cytokine-cytokine receptor interaction epz04151   PI3K-Akt signaling pathway epz04217   Necroptosis epz04620   Toll-like receptor signaling pathway epz04621   NOD-like receptor signaling pathway epz04622   RIG-I-like receptor signaling pathway epz04623   Cytosolic DNA-sensing pathway epz04630   JAK-STAT signaling pathway epz04650   Natural killer cell mediated cytotoxicity epz04936   Alcoholic liver disease epz05152   Tuberculosis epz05160   Hepatitis C epz05161   Hepatitis B epz05162   Measles epz05163   Human cytomegalovirus infection epz05164   Influenza A epz05165   Human papillomavirus infection epz05167   Kaposi sarcoma-associated herpesvirus infection epz05168   Herpes simplex virus 1 infection epz05169   Epstein-Barr virus infection epz05170   Human immunodeficiency virus 1 infection epz05171   Coronavirus disease - COVID-19 epz05200   Pathways in cancer epz05320   Autoimmune thyroid disease epz05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:epz00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     139078534    04151 PI3K-Akt signaling pathway     139078534   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     139078534  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     139078534  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     139078534    04621 NOD-like receptor signaling pathway     139078534    04622 RIG-I-like receptor signaling pathway     139078534    04623 Cytosolic DNA-sensing pathway     139078534    04650 Natural killer cell mediated cytotoxicity     139078534  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     139078534   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     139078534    05161 Hepatitis B     139078534    05160 Hepatitis C     139078534    05171 Coronavirus disease - COVID-19     139078534    05164 Influenza A     139078534    05162 Measles     139078534    05168 Herpes simplex virus 1 infection     139078534    05163 Human cytomegalovirus infection     139078534    05167 Kaposi sarcoma-associated herpesvirus infection     139078534    05169 Epstein-Barr virus infection     139078534    05165 Human papillomavirus infection     139078534   09171 Infectious disease: bacterial    05152 Tuberculosis     139078534   09163 Immune disease    05320 Autoimmune thyroid disease     139078534   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     139078534   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     139078534  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:epz04052]     139078534 Cytokines and neuropeptides [BR:epz04052]  Cytokines   Interferons    139078534 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  139078534 NCBI-ProteinID:  XP_070446208 LinkDB All DBs Position 22:38683350..38685913 Genome browser AA seq 214 aa AA seqDB search MHKGRSSENPETKAHRSPTPARPAASARSPMALPVSLLMALVVLSCHSSCSLGCDLPHTH SLGNTRVLMLLGQMRRISPFSCLKDRNDFGFPQEVFDGNQFRKAQAISAVHETIQQIFHL FSTDGSSAAWDESLLDKLYTGLYQQLTELEACLSQEVGVEETPLMNEDSLLAVRRYFQRI ALYLQEKKYSPCAWEIVRAEIMRSFSSSTNLPQS NT seq 645 nt NT seq  +upstreamnt  +downstreamnt atgcacaaaggaaggtcttcagaaaacccagagaccaaggctcacaggtcacccacccca gccaggccagcagcatctgcaagatccccaatggctctacctgtttccttactgatggcc ctggtggtgctcagctgccactccagctgctctctgggatgtgacctgcctcacacccat agcctgggcaacacaagggtcttgatgctcctgggacaaatgaggagaatctcccccttc tcctgcctgaaggacagaaatgactttggattcccccaggaggtgtttgacggcaaccag ttccggaaggctcaagccatctccgcggtccatgagacgatccaacagatcttccacctc ttcagcacagacggctcgtctgctgcctgggacgagagcctcctagacaagctctacact ggactctatcagcagctgactgagctggaagcctgtctgagccaggaggtgggggtggaa gagacgcccctgatgaacgaggactccctgctggctgtgaggagatacttccaaagaatc gctctctatctgcaagagaagaaatacagcccttgtgcctgggagatcgtcagagcagaa atcatgagatccttctcttcatccacaaacttgccgcagagttaa

DBGET integrated database retrieval system