Equus przewalskii (Przewalski's horse): 139081443 Help Entry 139081443         CDS       T04644                                  Name (RefSeq) histone H3   KO K11253   histone H3 Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04613   Neutrophil extracellular trap formation epz05034   Alcoholism epz05202   Transcriptional misregulation in cancer epz05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:epz00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     139081443  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     139081443   09163 Immune disease    05322 Systemic lupus erythematosus     139081443   09165 Substance dependence    05034 Alcoholism     139081443  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:epz03036]     139081443   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:epz04147]     139081443 Chromosome and associated proteins [BR:epz03036]  Eukaryotic type   Nucleosome assembly factors    Histones     139081443 Exosome [BR:epz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    139081443 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  139081443 NCBI-ProteinID:  XP_070463307 UniProt:  A0ABM4NED3 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgtactaagcagaccgcccgcaagtcgaccggcggcaaggccccgcggaagcag ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtgaagaagccgcac cgctaccggccgggcaccgtggccctgcgggagatccggcgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag acggaccttcgcttccagagctcggccgtgatggcgctgcaggaggcgagcgaggcctac ctggtggggctgttcgaagacaccaacctgtgcgccatccacgccaagcgggtgaccatc atgcccaaggacatccagttggcccgccgcatccgcggggagcgggcttaa

DBGET integrated database retrieval system