Equus przewalskii (Przewalski's horse): 139085512 Help Entry 139085512         CDS       T04644                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04010   MAPK signaling pathway epz04014   Ras signaling pathway epz04015   Rap1 signaling pathway epz04024   cAMP signaling pathway epz04072   Phospholipase D signaling pathway epz04137   Mitophagy - animal epz04140   Autophagy - animal epz04218   Cellular senescence epz04360   Axon guidance epz04371   Apelin signaling pathway epz04625   C-type lectin receptor signaling pathway epz04810   Regulation of actin cytoskeleton epz05132   Salmonella infection epz05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:epz00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     139085512 (RRAS)    04014 Ras signaling pathway     139085512 (RRAS)    04015 Rap1 signaling pathway     139085512 (RRAS)    04371 Apelin signaling pathway     139085512 (RRAS)    04072 Phospholipase D signaling pathway     139085512 (RRAS)    04024 cAMP signaling pathway     139085512 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     139085512 (RRAS)    04137 Mitophagy - animal     139085512 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     139085512 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     139085512 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     139085512 (RRAS)   09158 Development and regeneration    04360 Axon guidance     139085512 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     139085512 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     139085512 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:epz04031]     139085512 (RRAS) GTP-binding proteins [BR:epz04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     139085512 (RRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Motif Other DBs NCBI-GeneID:  139085512 NCBI-ProteinID:  XP_070489285 LinkDB All DBs Position 9:complement(18886574..18890517) Genome browser AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICTVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVS KLFTQILRVKDRDDFPIVLVGNKADLETQRQVPRSEASAFSASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPSPPSAPRKKDGGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcggggggccggga cccggggaccccccacccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcctacttcgtgtctgactacgacccc accattgaagactcctacacgaagatctgcacggtggatggcatcccagctcggctggac atcctggacaccgcgggccaggaggagttcggtgccatgcgggaacagtacatgcgtgcc ggccacggcttcctgctggtgtttgctattaatgaccggcagagctttaacgaggtgagc aagctctttacgcagatcctccgagtcaaggaccgcgatgacttccccatcgtgttggtc gggaacaaggcagatctggagacacagcgccaggtcccccgatctgaagcctccgccttc agcgcctcccaccacgtggcctacttcgaggcctccgccaaattgcgtctcaacgtggac gaagctttcgagcagctggtgcgcgcggtccggaagtatcaggagcaagagctcccaccc agtccacccagtgcccccaggaagaaggacgggggctgcccctgcgtcctcctgtag

DBGET integrated database retrieval system