Equus przewalskii (Przewalski's horse): 19019458 Help Entry 19019458          CDS       T04644                                  Symbol ND6 Name (RefSeq) NADH dehydrogenase subunit 6   KO K03884   NADH-ubiquinone oxidoreductase chain 6 [EC:7.1.1.2] Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz00190   Oxidative phosphorylation epz01100   Metabolic pathways epz04714   Thermogenesis epz04723   Retrograde endocannabinoid signaling epz05010   Alzheimer disease epz05012   Parkinson disease epz05014   Amyotrophic lateral sclerosis epz05016   Huntington disease epz05020   Prion disease epz05022   Pathways of neurodegeneration - multiple diseases epz05208   Chemical carcinogenesis - reactive oxygen species epz05415   Diabetic cardiomyopathy Module epz_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:epz00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     19019458 (ND6)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     19019458 (ND6)   09159 Environmental adaptation    04714 Thermogenesis     19019458 (ND6)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     19019458 (ND6)   09164 Neurodegenerative disease    05010 Alzheimer disease     19019458 (ND6)    05012 Parkinson disease     19019458 (ND6)    05014 Amyotrophic lateral sclerosis     19019458 (ND6)    05016 Huntington disease     19019458 (ND6)    05020 Prion disease     19019458 (ND6)    05022 Pathways of neurodegeneration - multiple diseases     19019458 (ND6)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     19019458 (ND6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:epz03029]     19019458 (ND6) Enzymes [BR:epz01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      19019458 (ND6) Mitochondrial biogenesis [BR:epz03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     19019458 (ND6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q3 Motif Other DBs NCBI-GeneID:  19019458 NCBI-ProteinID:  YP_009026983 UniProt:  X5I3K3 LinkDB All DBs Position MT Genome browser AA seq 175 aa AA seqDB search MMTYIVFILSVIFVVSFVGFSSKPSPIYGGLVLIVSGGVGCGIIMNFGGSFLGLMVFLIY LGGMLVVFGYTTAMATEQYPEVWVSNTTVMGVFLLGLLMEVMLVLYVLKSEEVGVVFEFS GVGDWAIYDTGDSGVFSEEIMGVAALYSYGAWVVIVTGWSLLVGVLVILEVTRGD NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atgatgacatatattgtgtttattttgagtgttatttttgttgttagttttgtggggttt tcttcaaaaccttcgcctatttatgggggtttagtgctgattgtaagtggaggggtcggt tgtggtattattatgaattttggagggtcctttttggggttgatggtgtttttgatttat ttgggaggaatgttggttgtttttggttatacaacggctatggctactgagcagtatcct gaggtatgggtgtctaatacgactgttatgggggtatttcttttagggttgttgatggag gttatgttggttttatatgttctgaagagtgaggaagtgggggtagtgtttgagtttagt ggtgtgggggattgagctatttatgatactggagattctggggtgtttagtgaggaaatt ataggggttgctgcattgtatagttatggggcttgggttgtgattgtgactggttgatcg ttgcttgttggggtcttggtaattttagaggttactcgtggagattaa

DBGET integrated database retrieval system