Enterobacter quasiroggenkampii: OM418_08095 Help Entry OM418_08095       CDS       T09002                                  Symbol dinI Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism equ  Enterobacter quasiroggenkampii Brite KEGG Orthology (KO) [BR:equ00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:equ03400]     OM418_08095 (dinI) DNA repair and recombination proteins [BR:equ03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     OM418_08095 (dinI) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI T4_RIIA1 KH_9 Motif Other DBs NCBI-ProteinID:  WFC84158 LinkDB All DBs Position complement(1731296..1731541) Genome browser AA seq 81 aa AA seqDB search MRIEVTIAKTTVLPAGALDALAGELSRRINNTFPDNAGAVTVRYAAANNLFVIGAAKEDK DRISEILQETWESADDWFITD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgtattgaagtcaccatagccaaaactaccgttctgcctgccggcgcgcttgatgca ctggcaggcgaattatcccgtcgtattaacaatacttttcctgacaacgcaggtgccgtc acggtgcgttacgccgcggcaaacaaccttttcgttattggtgccgcaaaagaagataaa gatcgcatcagcgaaatcctgcaggaaacgtgggaaagcgctgacgactggttcatcacg gattaa

DBGET integrated database retrieval system