Agathobacter rectalis M104/1: ERE_13380 Help Entry ERE_13380         CDS       T02588                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism era  Agathobacter rectalis M104/1 Pathway era01100   Metabolic pathways era01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:era00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ERE_13380    00074 Mycolic acid biosynthesis     ERE_13380   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ERE_13380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 DUF7080 PP-binding_2 Ribosomal_L12_N Bac_DnaA_C DUF1493 Motif Other DBs NCBI-ProteinID:  CBK93332 LinkDB All DBs Position complement(1377712..1377945) Genome browser AA seq 77 aa AA seqDB search MLEKIKEIVADQLGIDEDDIKLESNFKEDLEADSLDLFELVMALEEEYGVEIPSEDLEKI ATVNDIIEYLKNKGVEA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgttggagaaaatcaaggaaatcgtagcagatcagttaggaattgacgaggatgatatc aaattagagtcaaacttcaaggaggatcttgaggcagattcattagatcttttcgagctt gtaatggcactcgaggaggagtacggagtagaaatcccttcagaggatttagagaaaatc gcaacagtaaacgacatcattgagtatcttaagaacaaaggtgtagaggcttaa

DBGET integrated database retrieval system