Eremothecium cymbalariae: Ecym_2501 Help Entry Ecym_2501         CDS       T02237                                  Name (RefSeq) Hypothetical protein   KO K13113   ubiquitin-like protein 5 Organism erc  Eremothecium cymbalariae Brite KEGG Orthology (KO) [BR:erc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:erc03041]     Ecym_2501   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:erc04052]     Ecym_2501 Spliceosome [BR:erc03041]  Complex B   Other components    Complex B specific factors     Ecym_2501 Cytokines and neuropeptides [BR:erc04052]  Neuropeptides   Unclassified    Ecym_2501 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Motif Other DBs NCBI-GeneID:  11468259 NCBI-ProteinID:  XP_003645040 UniProt:  G8JPW5 LinkDB All DBs Position 2:complement(982410..982631) Genome browser AA seq 73 aa AA seqDB search MIEVIVNDRLGKKVTIKCLPTDTIGDFKKVLSIQLGSSHNKLVLQKGGSSLKDLITLEDY EIHDGTNLELYYL NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaagtcattgttaatgaccgtctgggaaagaaggtaactatcaagtgcctgcct actgatactataggtgatttcaaaaaagttctttctatacagctgggttcttcccacaac aagctagttttacaaaaggggggctcctccttgaaggatctcattacgttagaagattac gagattcacgatggaaccaatttggaattatattatttgtga

DBGET integrated database retrieval system