KEGG   Eremothecium cymbalariae: Ecym_3577
Entry
Ecym_3577         CDS       T02237                                 
Name
(RefSeq) Hypothetical protein
  KO
K12414  DNA replication licensing factor, required for pre-replication complex assembly
Organism
erc  Eremothecium cymbalariae
Pathway
erc04111  Cell cycle - yeast
erc04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:erc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    Ecym_3577
   04113 Meiosis - yeast
    Ecym_3577
SSDB
Motif
Pfam: CDT1_C Med10 HupF_HypC
Other DBs
NCBI-GeneID: 11471129
NCBI-ProteinID: XP_003645864
UniProt: G8JQR3
LinkDB
Position
3:complement(1095639..1097315)
AA seq 558 aa
MVSKAQIIDLNLIQNEQNLYELVRQTLQRYDTFLLKNYANYENLRELVEELGKNVPDTEL
GFDANFTGVLVGEDCSVEQYIYNSDSRWQFPRYCDNELLNKLHSRLVKLSLYFSRLCLQS
VMEGEIDDSILSKGNNCTIIRRYFSRNVSSSVLPGLSFDYADEYKLFQPVGLLSVFPVAK
NIQTNVDGKWVTVQEDDCVLIHTGVLMEKLSKGFQTSGPIKILKNSSSIHIEMSPALNFK
VESCDSTLGQLLLNQMIKQFPEVAQKFYATELNKIQLEKLVASLKSLYQHANSVLALYKI
NHPVADYVEAEQLLPQISSMAKWKITETQILRMMYIWHKSFSLVRKEDYSILFSLKDVSI
STNKTKMLQFSDRIDSWLRSFLESEPKELTLEIPQFKISDIPILKRPQSSGKSVWRKMGS
CNVTSLKGVSKACSTRDSTNSNNLLERIRIKESKASELLSKREFLWEKFLKVKQRQVFDI
LVTLPAQTPYTSSYLIPLIVDSLRDSNNPVGEREVEQILGNLQTILQDKMTISEVDGGLK
VYKWKLLDKNFSLNKIKL
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggtatctaaggcgcagataattgacttgaatttaatccagaatgagcagaatttgtat
gagttggtgaggcagactttgcaacggtatgacacttttctgttgaaaaattatgccaac
tacgaaaatctacgagaattggtggaggagctaggtaagaatgttccagacactgagctt
gggttcgatgctaactttacaggggtattggtgggcgaggattgcagtgttgaacaatat
atatacaattctgattcgagatggcagtttccgaggtactgtgataatgagttactgaac
aagctccactcacgtctagtgaaattgtcattgtatttcagtagattatgccttcagtct
gtgatggagggcgagatagacgattctatactgagtaaggggaataactgcactataatt
aggagatacttttctcgtaatgtatcgtcatctgttcttccgggacttagctttgactac
gctgatgaatacaaactgtttcaacctgtggggctactttcggtgtttccggttgctaag
aacatacaaacgaatgtcgatggtaagtgggtgacggtgcaagaggatgattgtgtttta
attcataccggtgttcttatggaaaaattgtccaaaggctttcaaacttcgggacctata
aagatcttgaagaattcgagctcgatccatatcgaaatgtcgccggcactaaattttaag
gttgagagctgtgattccacgttaggtcaacttctgttgaaccaaatgataaagcaattc
ccagaagttgcccaaaagttttatgctacagaactaaataaaatacagttggaaaaattg
gttgcgtctttaaaatcattatatcaacatgctaattcggtgctggctctatataagata
aaccaccctgttgctgactatgttgaagcggagcaattactccctcagattagttctatg
gcaaagtggaaaataaccgagactcaaatcctcagaatgatgtatatctggcacaaatct
ttctctctggtaagaaaggaggattattctatcttattttcactcaaggatgtatcaatt
agcacaaataagaccaagatgttacaatttagcgataggattgattcttggttacgtagc
ttcttggaaagtgaaccaaaggagcttactttagagattccacagttcaaaatttcagat
atcccaatcttgaagcgtcctcagagcagtggtaaatccgtttggaggaaaatggggagc
tgcaatgtaacttccctgaaaggtgtttcgaaggcatgcagtactcgtgatagcacaaat
tcaaacaatttgttagagagaattagaatcaaggagagtaaagcttcagaattattgtcc
aaaagagagtttctgtgggaaaagtttctgaaggttaagcaaagacaggtattcgatatt
ttggtcactttgcctgcgcagacgccatatacatctagctatctcattccattaatagtg
gattcactgagagattccaataacccagttggcgaaagagaggttgagcagatcttagga
aatctccaaaccatacttcaagataaaatgacaatttcagaagttgatggcgggttaaag
gtctataaatggaaactcttggataagaatttctctctaaataagatcaagctctaa

DBGET integrated database retrieval system