Eremothecium cymbalariae: Ecym_5333 Help Entry Ecym_5333         CDS       T02237                                  Name (RefSeq) hypothetical protein   KO K11511   centromere protein S Organism erc  Eremothecium cymbalariae Pathway erc03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:erc00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     Ecym_5333  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:erc03036]     Ecym_5333    03400 DNA repair and recombination proteins [BR:erc03400]     Ecym_5333 Chromosome and associated proteins [BR:erc03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      Ecym_5333 DNA repair and recombination proteins [BR:erc03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      Ecym_5333 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C TFIID-18kDa Motif Other DBs NCBI-GeneID:  11468404 NCBI-ProteinID:  XP_003646909 UniProt:  I6NDF0 LinkDB All DBs Position 5:complement(678525..678857) Genome browser AA seq 110 aa AA seqDB search MSDNQERNKKLVGQLKGKLWFCIEQHVKRELPLGVTFTPKFINALVELCFAQLTDLGADL EAFARHAGRETIVSDDFMLRLRKNPDLQQFLREELATTKTAQPARSSARK NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgtcggataatcaggagcggaacaagaagcttgttgggcagctcaaggggaaactctgg ttctgcattgaacagcacgtgaaacgtgagctcccactgggagtgactttcacgcccaag ttcatcaacgcactagtcgagctgtgcttcgcacagctcacagacctgggcgcggatctg gaggcattcgcaagacacgccggcagagagactatagtaagcgacgacttcatgctgcgg ttgcgcaagaatccagatctacaacaattcctccgcgaggaactggccacgaccaagacc gcgcaacctgcgcgctcaagcgcgcgcaagtag

DBGET integrated database retrieval system