Eremothecium cymbalariae: Ecym_6453 Help Entry Ecym_6453         CDS       T02237                                  Name (RefSeq) hypothetical protein   KO K00730   dolichyl-diphosphooligosaccharide---protein glycosyltransferase subunit 4 Organism erc  Eremothecium cymbalariae Pathway erc00510   N-Glycan biosynthesis erc00513   Various types of N-glycan biosynthesis erc01100   Metabolic pathways erc04141   Protein processing in endoplasmic reticulum Module erc_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:erc00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     Ecym_6453    00513 Various types of N-glycan biosynthesis     Ecym_6453  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     Ecym_6453 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost4 DUF6019 UcrQ Motif Other DBs NCBI-GeneID:  11472363 NCBI-ProteinID:  XP_003647641 UniProt:  G8JUP4 LinkDB All DBs Position 6:879801..879926 Genome browser AA seq 41 aa AA seqDB search MITDNQLNTLAISFGLVMFTFIVFYYIIDFAVKKKEDIKRE NT seq 126 nt NT seq  +upstreamnt  +downstreamnt atgattacagataaccaactgaataccttggctatttcttttggcttagttatgttcact tttatagtgttctattacataatagacttcgctgttaaaaagaaggaagacataaaaaga gagtga

DBGET integrated database retrieval system