Eremothecium cymbalariae: Ecym_8313 Help Entry Ecym_8313         CDS       T02237                                  Name (RefSeq) Hypothetical protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism erc  Eremothecium cymbalariae Pathway erc03020   RNA polymerase erc03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:erc00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     Ecym_8313   09124 Replication and repair    03420 Nucleotide excision repair     Ecym_8313  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:erc03021]     Ecym_8313    03400 DNA repair and recombination proteins [BR:erc03400]     Ecym_8313 Transcription machinery [BR:erc03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      Ecym_8313   RNA polymerase III system    RNA polymerase III      Ecym_8313   RNA polymerase I system    RNA polymerase I      Ecym_8313 DNA repair and recombination proteins [BR:erc03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       Ecym_8313 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N Chordopox_RPO7 Motif Other DBs NCBI-GeneID:  11471540 NCBI-ProteinID:  XP_003648408 UniProt:  G8JXL7 LinkDB All DBs Position 8:638979..639191 Genome browser AA seq 70 aa AA seqDB search MIVPVRCFSCGKVVGDKWEAYLNMLQEEELDEGTALSRLGLKRYCCRRMILTHVDLIEKF LRYNPLEKRD NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgattgtgccagttagatgtttctcttgtggtaaggttgttggggacaagtgggaggca tatttgaacatgctacaagaggaagaacttgatgaaggtactgccttgtcaagattaggc ttgaagagatattgctgcaggagaatgatcttgacacatgtggacttgattgagaagttt ttgagatacaatccactagagaagagggactga

DBGET integrated database retrieval system