Agathobacter rectalis ATCC 33656: EUBREC_1499 Help Entry EUBREC_1499       CDS       T00909                                  Name (GenBank) Hypothetical protein   KO K02078   acyl carrier protein Organism ere  Agathobacter rectalis ATCC 33656 Pathway ere01100   Metabolic pathways ere01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ere00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EUBREC_1499    00074 Mycolic acid biosynthesis     EUBREC_1499   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EUBREC_1499 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Motif Other DBs NCBI-ProteinID:  ACR75253 UniProt:  C4Z922 LinkDB All DBs Position 1378936..1379172 Genome browser AA seq 78 aa AA seqDB search MEFEKLRDIIVEVLNVDETEVTMESTFIDDLGADSLDVFQIIMGIEEEFDIEIPNEEAEK IVTVGDAVEQIKKAVSEQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggaatttgagaagcttagagacattattgtcgaggtacttaatgtggacgagaccgag gttactatggagtcaaccttcattgatgatcttggcgctgactctctggatgtattccag attatcatgggtatcgaggaagagttcgatatcgagattcctaatgaggaagcagagaaa atcgtcactgtaggcgatgctgttgagcagattaaaaaagctgtaagcgagcagtag

DBGET integrated database retrieval system