Agathobacter rectalis ATCC 33656: EUBREC_1740 Help Entry EUBREC_1740       CDS       T00909                                  Name (GenBank) Hypothetical protein   KO K03608   cell division topological specificity factor Organism ere  Agathobacter rectalis ATCC 33656 Brite KEGG Orthology (KO) [BR:ere00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ere03036]     EUBREC_1740   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ere04812]     EUBREC_1740 Chromosome and associated proteins [BR:ere03036]  Prokaryotic type   Chromosome partitioning proteins    Inhibitors of FtsZ assembly     EUBREC_1740 Cytoskeleton proteins [BR:ere04812]  Prokaryotic cytoskeleton proteins   MinD / ParA class of bacterial cytoskeletal proteins    EUBREC_1740 SSDB OrthologParalogGFIT Motif Pfam:  MinE Motif Other DBs NCBI-ProteinID:  ACR75484 UniProt:  C4ZA43 LinkDB All DBs Position complement(1616660..1616872) Genome browser AA seq 70 aa AA seqDB search MMHKFSKTGEYAKKRLKIALAEDRSTISASDNMAQIKKEIKSVIQRHMNINDEAYEVRII MRDKKSINNL NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgatgcataaattttccaaaacaggagaatacgcaaagaaaaggcttaaaatagcactt gcagaagataggagcacaatatctgcttctgacaatatggcacagattaaaaaagaaata aaaagcgtgatacaaagacatatgaatataaacgatgaagcttacgaagtccggattatc atgcgcgacaaaaaatcaattaataacctttaa

DBGET integrated database retrieval system