Erythrobacter sp. THAF29: FIU90_04890
Help
Entry
FIU90_04890 CDS
T06318
Symbol
cheY
Name
(GenBank) Chemotaxis protein CheY
KO
K03413
two-component system, chemotaxis family, chemotaxis protein CheY
Organism
erf
Erythrobacter sp. THAF29
Pathway
erf02020
Two-component system
erf02030
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:
erf00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
FIU90_04890 (cheY)
09140 Cellular Processes
09142 Cell motility
02030 Bacterial chemotaxis
FIU90_04890 (cheY)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
erf02022
]
FIU90_04890 (cheY)
02035 Bacterial motility proteins [BR:
erf02035
]
FIU90_04890 (cheY)
Two-component system [BR:
erf02022
]
CheA family
CheA-CheYBV (chemotaxis)
FIU90_04890 (cheY)
Bacterial motility proteins [BR:
erf02035
]
Flagellar system
Chemotaxis proteins
Two component system proteins
FIU90_04890 (cheY)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
Receiver_CRE1
Motif
Other DBs
NCBI-ProteinID:
QFT76870
LinkDB
All DBs
Position
complement(982109..982474)
Genome browser
AA seq
121 aa
AA seq
DB search
MKTCLIVDDSRVIRRVSRHILETLGFEVEEAENGQEGLDACDARMPDVVLLDWNMPVMTG
IEFIIQLRRRPGGDKPKVVFCTTENDVAHIREAIQAGADEYVMKPFDHETLQIKLQLVGF
A
NT seq
366 nt
NT seq
+upstream
nt +downstream
nt
atgaaaacgtgtctgattgtcgatgattcccgggtaatccgcagggtttcaagacatatc
ctcgaaacgctcggattcgaggtcgaagaagccgaaaacgggcaggaagggctcgacgca
tgcgatgcccgcatgcccgatgtcgtcttgctcgactggaacatgccggtgatgaccggg
atcgaattcatcatccagctgcgcaggcggcccggcggcgacaagcccaaggtcgttttc
tgcaccaccgaaaacgacgttgcgcacatacgcgaggcgatccaggcgggcgctgacgag
tatgtgatgaagccgttcgaccacgaaacgcttcagatcaaactgcagctggtcggcttc
gcgtga
DBGET
integrated database retrieval system