KEGG   Erwinia sp. Ejp617: EJP617_12420
Entry
EJP617_12420      CDS       T01935                                 
Symbol
coaD
Name
(GenBank) Phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
erj  Erwinia sp. Ejp617
Pathway
erj00770  Pantothenate and CoA biosynthesis
erj01100  Metabolic pathways
erj01240  Biosynthesis of cofactors
Module
erj_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:erj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    EJP617_12420 (coaD)
Enzymes [BR:erj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     EJP617_12420 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: ADP10923
LinkDB
Position
complement(1370693..1371169)
AA seq 158 aa
MSTKAIYPGTFDPMTNGHLDIVTRAARIFDRIVLAIAASPSKKPMFSLEERVALASEVVA
HLPNVDVVGFSDLLANFAKAQQANVLVRGLRAVSDFEYEMQLAQMNRHLLPTLESVFLMP
SEQYAFISSSLMKEVARHGGDVESFLPTAVYRALKARF
NT seq 477 nt   +upstreamnt  +downstreamnt
atgagcacaaaagccatctatcccggcacctttgatccgatgaccaacggacatcttgac
atcgtgacacgcgctgcacggatattcgatcgcatagtactggcgatcgccgcaagcccg
agcaaaaaaccgatgttctcccttgaggagcgagtcgcgctggcaagcgaagtggttgcg
catttaccgaatgttgacgttgtgggattcagtgatttgctggccaacttcgccaaagca
cagcaggctaatgtgctggtgcgcggcctgcgggcggtgtctgattttgagtatgaaatg
cagctggcacagatgaaccgccacctgttgccgacgctggaaagcgtgtttctgatgcct
tcagagcaatatgcctttatttcttcttccctgatgaaagaagtggcgcgccacggcggt
gatgtagagagtttcctgccgacggcggtttaccgggcgcttaaagcgaggttctga

DBGET integrated database retrieval system