KEGG   Erythrobacter sp. KY5: CD351_13735
Entry
CD351_13735       CDS       T05511                                 
Name
(GenBank) type VI secretion protein
  KO
K03195  type IV secretion system protein VirB10
Organism
erk  Erythrobacter sp. KY5
Pathway
erk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:erk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CD351_13735
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:erk02044]
    CD351_13735
Secretion system [BR:erk02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   CD351_13735
SSDB
Motif
Pfam: TrbI
Other DBs
NCBI-ProteinID: AWW75492
LinkDB
Position
complement(2887446..2888615)
AA seq 389 aa
MAVADHEGDEVMRLAMRLPPKKGENGNTEAGDPRDGESAEVIDLASRNGYSAVAERKTKT
EGLGLAAGVAIVGLLGATTFWAMTAAELPEAEATGGVGAQPAQAAAVPATQPAVAPVPAP
VVARPDPAPAPILANPPAVAIGPGTNPFASPTMIYDASRNALNAQAAGTAPGAVAATGPG
AGDSGAIGSAAAFASAVGGVGGAPAQARPMVNPATTVTEGTMIPAVLETAINTDVPGYVR
AVVSQDVRSFDGTNVLIPRSSRLIGQYQSGVQQGQKRAYVIWTRLIRPDGASVNIASPAV
AFDGTTGLEGDVNNHFFRRFGSAMLLSVVGGLGAIATGGTSVVLGGAGQSAASIAAQQDG
QISPTIRVRMGEPIRVFTARDLDFTGVAE
NT seq 1170 nt   +upstreamnt  +downstreamnt
atcgcggtcgcggatcatgagggagatgaagtaatgcgtcttgccatgcgtcttccgccc
aagaagggcgaaaacggtaacactgaggccggcgatccgcgcgacggtgaatccgctgag
gttatcgatcttgcgagccgtaatggctattccgcggttgccgagcggaagaccaaaacc
gaaggactcgggcttgctgctggtgtcgcgattgtcggattgctgggggcgacaacgttc
tgggcgatgaccgcggcggaactgccagaggccgaagcaacgggcggagttggcgcgcag
ccagctcaggccgcagccgtgcctgccacgcagccggcggtagctccggttcctgcccct
gtcgttgcgcggccagatccggcacctgcgccgatcctcgccaatccgcctgctgttgca
attggaccggggaccaatccgttcgccagcccgacgatgatttacgatgcaagccgcaac
gcgctcaacgcgcaggcggccggaacggcgcccggtgcggtggccgccactggccccggt
gccggtgattccggtgccatcggctcggcagcagcgtttgctagcgcagttggcggtgtc
ggcggcgctccggcgcaggctcgcccgatggtcaatccggccacgactgtgaccgaaggg
accatgatcccggcggtgctcgaaaccgcgatcaacaccgatgtgccgggctatgtccgc
gcagttgtgagccaggacgtacgcagctttgatggcacgaatgtgctcatcccgcgctct
tcgcgcttgatcggccagtaccagtcgggcgtccagcagggtcaaaagcgcgcctatgtg
atctggacccgattgatccgcccggacggcgcttcggttaacatcgcctctccggcagtg
gcgttcgatgggaccacgggccttgaaggcgatgtgaacaaccacttcttccgccgcttc
ggttcggccatgctcttgtcagtagtcggcgggcttggcgcgattgccacgggcgggact
tcggttgtactcggcggcgctggtcagagcgctgccagcattgcggcgcagcaggacggc
cagattagcccgaccattcgcgtgcgcatgggtgaaccgatccgggtgtttacggcgcgt
gatcttgacttcaccggcgtggccgagtga

DBGET integrated database retrieval system