Enterobacter roggenkampii DSM 16690: BFV67_00585 Help Entry BFV67_00585       CDS       T05556                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism ern  Enterobacter roggenkampii DSM 16690 Brite KEGG Orthology (KO) [BR:ern00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ern03110]     BFV67_00585 Chaperones and folding catalysts [BR:ern03110]  Protein folding catalysts   Protein disulfide isomerase    BFV67_00585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR CLIC-like_N GST_N Motif Other DBs NCBI-ProteinID:  AOP93748 UniProt:  A0A167S0U9 LinkDB All DBs Position 133252..133503 Genome browser AA seq 83 aa AA seqDB search MAHIEIYTKATCPFCHRAKALLNSKGVTFQELPIDGDAIKREEMIQRSGRTTVPQIFIDA QHIGGCDDLYALDARGGLDPLLS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggcccatattgagatctacaccaaagcgacgtgcccgttctgccaccgtgcgaaagcg ctgctgaacagcaaaggcgtcacgttccaggaactgccgattgacggtgacgcgattaaa cgcgaagagatgatccaacgtagtggtcgtacgacggttccacagatttttattgatgcg cagcacattggcggctgtgatgacttgtatgcgctcgatgcccgtggtggactcgatccg ctgctgagctaa

DBGET integrated database retrieval system