Enterobacter roggenkampii DSM 16690: BFV67_08135 Help Entry BFV67_08135       CDS       T05556                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ern  Enterobacter roggenkampii DSM 16690 Pathway ern01100   Metabolic pathways ern01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ern00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BFV67_08135    00074 Mycolic acid biosynthesis     BFV67_08135   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BFV67_08135 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 HLH Motif Other DBs NCBI-ProteinID:  AOP95154 UniProt:  A0A167P0F2 LinkDB All DBs Position 1747033..1747269 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttgtgaactccgcttccttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system