Erwinia rhapontici: LJN55_08375 Help Entry LJN55_08375       CDS       T08392                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism erp  Erwinia rhapontici Pathway erp01100   Metabolic pathways erp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:erp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LJN55_08375 (acpP)    00074 Mycolic acid biosynthesis     LJN55_08375 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LJN55_08375 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH TerB Motif Other DBs NCBI-ProteinID:  UDQ81833 LinkDB All DBs Position 1755526..1755762 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNTASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcattggcgagcagctgggcgttaagcag gaagaagttgttaatactgcctcttttgtagaagatctgggcgctgattctcttgatacc gttgagctggtaatggctctggaagaagagtttgataccgagattccggacgaagaagct gagaaaatcactaccgttcaggctgctattgattatatcaatggtcaccaggcataa

DBGET integrated database retrieval system