Erwinia rhapontici: LJN55_09970 Help Entry LJN55_09970       CDS       T08392                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism erp  Erwinia rhapontici Pathway erp01100   Metabolic pathways erp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:erp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LJN55_09970    00074 Mycolic acid biosynthesis     LJN55_09970   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LJN55_09970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UDQ82133 LinkDB All DBs Position complement(2111465..2111725) Genome browser AA seq 86 aa AA seqDB search MINHDAVMNYIIQCLQNMVASDVEIHPDSNLIDELGLESIKVMDLLMMLEDRFDIPIPIN ILLDVRTPEQLRDALLPHLEKTYGPL NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgataaatcatgatgctgtaatgaattatattattcaatgtttgcagaatatggtcgcc agtgacgtggagatacatcctgacagcaatctcattgatgaactgggcctggagtccatc aaggtcatggatctgttaatgatgttagaagacagatttgatattcccattccgataaat attttgctggatgtcagaacacccgaacagctgcgggatgctttacttcctcacctggag aaaacgtatgggcctttatga

DBGET integrated database retrieval system