KEGG   Eulemur rufifrons (Bennett's brown lemur): 138394041
Entry
138394041         CDS       T11398                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
eruf  Eulemur rufifrons (Bennett's brown lemur)
Pathway
eruf01521  EGFR tyrosine kinase inhibitor resistance
eruf01522  Endocrine resistance
eruf01524  Platinum drug resistance
eruf04010  MAPK signaling pathway
eruf04012  ErbB signaling pathway
eruf04014  Ras signaling pathway
eruf04015  Rap1 signaling pathway
eruf04022  cGMP-PKG signaling pathway
eruf04024  cAMP signaling pathway
eruf04062  Chemokine signaling pathway
eruf04066  HIF-1 signaling pathway
eruf04068  FoxO signaling pathway
eruf04071  Sphingolipid signaling pathway
eruf04072  Phospholipase D signaling pathway
eruf04114  Oocyte meiosis
eruf04140  Autophagy - animal
eruf04148  Efferocytosis
eruf04150  mTOR signaling pathway
eruf04151  PI3K-Akt signaling pathway
eruf04210  Apoptosis
eruf04218  Cellular senescence
eruf04261  Adrenergic signaling in cardiomyocytes
eruf04270  Vascular smooth muscle contraction
eruf04350  TGF-beta signaling pathway
eruf04360  Axon guidance
eruf04370  VEGF signaling pathway
eruf04371  Apelin signaling pathway
eruf04380  Osteoclast differentiation
eruf04510  Focal adhesion
eruf04517  IgSF CAM signaling
eruf04520  Adherens junction
eruf04540  Gap junction
eruf04550  Signaling pathways regulating pluripotency of stem cells
eruf04611  Platelet activation
eruf04613  Neutrophil extracellular trap formation
eruf04620  Toll-like receptor signaling pathway
eruf04621  NOD-like receptor signaling pathway
eruf04625  C-type lectin receptor signaling pathway
eruf04650  Natural killer cell mediated cytotoxicity
eruf04657  IL-17 signaling pathway
eruf04658  Th1 and Th2 cell differentiation
eruf04659  Th17 cell differentiation
eruf04660  T cell receptor signaling pathway
eruf04662  B cell receptor signaling pathway
eruf04664  Fc epsilon RI signaling pathway
eruf04666  Fc gamma R-mediated phagocytosis
eruf04668  TNF signaling pathway
eruf04713  Circadian entrainment
eruf04720  Long-term potentiation
eruf04722  Neurotrophin signaling pathway
eruf04723  Retrograde endocannabinoid signaling
eruf04724  Glutamatergic synapse
eruf04725  Cholinergic synapse
eruf04726  Serotonergic synapse
eruf04730  Long-term depression
eruf04810  Regulation of actin cytoskeleton
eruf04910  Insulin signaling pathway
eruf04912  GnRH signaling pathway
eruf04914  Progesterone-mediated oocyte maturation
eruf04915  Estrogen signaling pathway
eruf04916  Melanogenesis
eruf04917  Prolactin signaling pathway
eruf04919  Thyroid hormone signaling pathway
eruf04921  Oxytocin signaling pathway
eruf04926  Relaxin signaling pathway
eruf04928  Parathyroid hormone synthesis, secretion and action
eruf04929  GnRH secretion
eruf04930  Type II diabetes mellitus
eruf04933  AGE-RAGE signaling pathway in diabetic complications
eruf04934  Cushing syndrome
eruf04935  Growth hormone synthesis, secretion and action
eruf04960  Aldosterone-regulated sodium reabsorption
eruf05010  Alzheimer disease
eruf05020  Prion disease
eruf05022  Pathways of neurodegeneration - multiple diseases
eruf05034  Alcoholism
eruf05132  Salmonella infection
eruf05133  Pertussis
eruf05135  Yersinia infection
eruf05140  Leishmaniasis
eruf05142  Chagas disease
eruf05145  Toxoplasmosis
eruf05152  Tuberculosis
eruf05160  Hepatitis C
eruf05161  Hepatitis B
eruf05163  Human cytomegalovirus infection
eruf05164  Influenza A
eruf05165  Human papillomavirus infection
eruf05166  Human T-cell leukemia virus 1 infection
eruf05167  Kaposi sarcoma-associated herpesvirus infection
eruf05170  Human immunodeficiency virus 1 infection
eruf05171  Coronavirus disease - COVID-19
eruf05200  Pathways in cancer
eruf05203  Viral carcinogenesis
eruf05205  Proteoglycans in cancer
eruf05206  MicroRNAs in cancer
eruf05207  Chemical carcinogenesis - receptor activation
eruf05208  Chemical carcinogenesis - reactive oxygen species
eruf05210  Colorectal cancer
eruf05211  Renal cell carcinoma
eruf05212  Pancreatic cancer
eruf05213  Endometrial cancer
eruf05214  Glioma
eruf05215  Prostate cancer
eruf05216  Thyroid cancer
eruf05218  Melanoma
eruf05219  Bladder cancer
eruf05220  Chronic myeloid leukemia
eruf05221  Acute myeloid leukemia
eruf05223  Non-small cell lung cancer
eruf05224  Breast cancer
eruf05225  Hepatocellular carcinoma
eruf05226  Gastric cancer
eruf05230  Central carbon metabolism in cancer
eruf05231  Choline metabolism in cancer
eruf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
eruf05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:eruf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    138394041 (MAPK3)
   04012 ErbB signaling pathway
    138394041 (MAPK3)
   04014 Ras signaling pathway
    138394041 (MAPK3)
   04015 Rap1 signaling pathway
    138394041 (MAPK3)
   04350 TGF-beta signaling pathway
    138394041 (MAPK3)
   04370 VEGF signaling pathway
    138394041 (MAPK3)
   04371 Apelin signaling pathway
    138394041 (MAPK3)
   04668 TNF signaling pathway
    138394041 (MAPK3)
   04066 HIF-1 signaling pathway
    138394041 (MAPK3)
   04068 FoxO signaling pathway
    138394041 (MAPK3)
   04072 Phospholipase D signaling pathway
    138394041 (MAPK3)
   04071 Sphingolipid signaling pathway
    138394041 (MAPK3)
   04024 cAMP signaling pathway
    138394041 (MAPK3)
   04022 cGMP-PKG signaling pathway
    138394041 (MAPK3)
   04151 PI3K-Akt signaling pathway
    138394041 (MAPK3)
   04150 mTOR signaling pathway
    138394041 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    138394041 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    138394041 (MAPK3)
   04148 Efferocytosis
    138394041 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    138394041 (MAPK3)
   04210 Apoptosis
    138394041 (MAPK3)
   04218 Cellular senescence
    138394041 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    138394041 (MAPK3)
   04520 Adherens junction
    138394041 (MAPK3)
   04540 Gap junction
    138394041 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    138394041 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    138394041 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    138394041 (MAPK3)
   04613 Neutrophil extracellular trap formation
    138394041 (MAPK3)
   04620 Toll-like receptor signaling pathway
    138394041 (MAPK3)
   04621 NOD-like receptor signaling pathway
    138394041 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    138394041 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    138394041 (MAPK3)
   04660 T cell receptor signaling pathway
    138394041 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    138394041 (MAPK3)
   04659 Th17 cell differentiation
    138394041 (MAPK3)
   04657 IL-17 signaling pathway
    138394041 (MAPK3)
   04662 B cell receptor signaling pathway
    138394041 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    138394041 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    138394041 (MAPK3)
   04062 Chemokine signaling pathway
    138394041 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    138394041 (MAPK3)
   04929 GnRH secretion
    138394041 (MAPK3)
   04912 GnRH signaling pathway
    138394041 (MAPK3)
   04915 Estrogen signaling pathway
    138394041 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    138394041 (MAPK3)
   04917 Prolactin signaling pathway
    138394041 (MAPK3)
   04921 Oxytocin signaling pathway
    138394041 (MAPK3)
   04926 Relaxin signaling pathway
    138394041 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    138394041 (MAPK3)
   04919 Thyroid hormone signaling pathway
    138394041 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    138394041 (MAPK3)
   04916 Melanogenesis
    138394041 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    138394041 (MAPK3)
   04270 Vascular smooth muscle contraction
    138394041 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    138394041 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    138394041 (MAPK3)
   04725 Cholinergic synapse
    138394041 (MAPK3)
   04726 Serotonergic synapse
    138394041 (MAPK3)
   04720 Long-term potentiation
    138394041 (MAPK3)
   04730 Long-term depression
    138394041 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    138394041 (MAPK3)
   04722 Neurotrophin signaling pathway
    138394041 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    138394041 (MAPK3)
   04380 Osteoclast differentiation
    138394041 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    138394041 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    138394041 (MAPK3)
   05206 MicroRNAs in cancer
    138394041 (MAPK3)
   05205 Proteoglycans in cancer
    138394041 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    138394041 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    138394041 (MAPK3)
   05203 Viral carcinogenesis
    138394041 (MAPK3)
   05230 Central carbon metabolism in cancer
    138394041 (MAPK3)
   05231 Choline metabolism in cancer
    138394041 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    138394041 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    138394041 (MAPK3)
   05212 Pancreatic cancer
    138394041 (MAPK3)
   05225 Hepatocellular carcinoma
    138394041 (MAPK3)
   05226 Gastric cancer
    138394041 (MAPK3)
   05214 Glioma
    138394041 (MAPK3)
   05216 Thyroid cancer
    138394041 (MAPK3)
   05221 Acute myeloid leukemia
    138394041 (MAPK3)
   05220 Chronic myeloid leukemia
    138394041 (MAPK3)
   05218 Melanoma
    138394041 (MAPK3)
   05211 Renal cell carcinoma
    138394041 (MAPK3)
   05219 Bladder cancer
    138394041 (MAPK3)
   05215 Prostate cancer
    138394041 (MAPK3)
   05213 Endometrial cancer
    138394041 (MAPK3)
   05224 Breast cancer
    138394041 (MAPK3)
   05223 Non-small cell lung cancer
    138394041 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    138394041 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    138394041 (MAPK3)
   05161 Hepatitis B
    138394041 (MAPK3)
   05160 Hepatitis C
    138394041 (MAPK3)
   05171 Coronavirus disease - COVID-19
    138394041 (MAPK3)
   05164 Influenza A
    138394041 (MAPK3)
   05163 Human cytomegalovirus infection
    138394041 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    138394041 (MAPK3)
   05165 Human papillomavirus infection
    138394041 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    138394041 (MAPK3)
   05135 Yersinia infection
    138394041 (MAPK3)
   05133 Pertussis
    138394041 (MAPK3)
   05152 Tuberculosis
    138394041 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    138394041 (MAPK3)
   05140 Leishmaniasis
    138394041 (MAPK3)
   05142 Chagas disease
    138394041 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    138394041 (MAPK3)
   05020 Prion disease
    138394041 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    138394041 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    138394041 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    138394041 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    138394041 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    138394041 (MAPK3)
   04934 Cushing syndrome
    138394041 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    138394041 (MAPK3)
   01524 Platinum drug resistance
    138394041 (MAPK3)
   01522 Endocrine resistance
    138394041 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eruf01001]
    138394041 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:eruf03036]
    138394041 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eruf04147]
    138394041 (MAPK3)
Enzymes [BR:eruf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     138394041 (MAPK3)
Protein kinases [BR:eruf01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   138394041 (MAPK3)
Chromosome and associated proteins [BR:eruf03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     138394041 (MAPK3)
Exosome [BR:eruf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   138394041 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 138394041
NCBI-ProteinID: XP_069341734
LinkDB
Position
14:419307..426107
AA seq 381 aa
MAAAAAAAQGGGGGEPRGADGVGPGVPGEVEIVKGQPFDVGPRYTQLQYIGEGAYGMVSS
AYDHMRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDV
YIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTC
DLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEM
LSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPK
SDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKE
RLKELIFQETARFQPGVLEAP
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctgcggctcaggggggcgggggcggggagccccggggagccgat
ggggtcggcccgggggtcccgggggaagtggagatagtgaaggggcagccgttcgacgtg
ggcccgcgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctca
gcttatgaccacatgcgcaagactcgagtggccatcaaaaagatcagccccttcgagcat
cagacgtactgccagcgcacgctgcgagagatccagatcttgctgcgattccgtcatgag
aatgtcattggcatccgagacattctgcgagcgcccaccctggaggccatgcgggatgtc
tacattgtgcaggacctaatggagacagacctgtataaattgctcaaaagccagcagctg
agcaacgaccacatctgctacttcctctaccagatcctgcggggcctcaagtatatccac
tcagccaacgtgctccaccgggatctaaagccctccaacctgctcattaacaccacctgc
gaccttaagatctgtgatttcggcctggctcggattgctgaccctgagcacgaccacact
ggctttctgacggaatatgtggccacacgctggtaccgcgccccagagatcatgctgaac
tctaagggctacaccaagtccattgacatctggtctgtgggctgcatcctggctgagatg
ctctccaaccggcccatcttccctggcaagcactacctggatcagctcaaccacattctg
ggcatcctgggctccccatcccaggaggacctcaattgcatcatcaacatgaaggctcga
aactacctacagtctctgccctccaagaccaaggtggcctgggccaaactgtttcccaag
tcggactccaaagcccttgacctgctggaccggatgttaacctttaaccccaacaaacgg
atcacagtggaggaagcactggctcacccctacctagagcagtactacgacccgacggat
gagccggtcgctgaggagcccttcaccttcgacatggagctggatgatctacccaaggag
cggctgaaggagctcatcttccaggagacagcccgcttccagcctggggtgctggaggcc
ccctaa

DBGET integrated database retrieval system