Escherichia ruysiae: OSH18_04320 Help Entry OSH18_04320       CDS       T09019                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eruy  Escherichia ruysiae Pathway eruy01100   Metabolic pathways eruy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eruy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     OSH18_04320 (acpP)    00074 Mycolic acid biosynthesis     OSH18_04320 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     OSH18_04320 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  WGM53383 LinkDB All DBs Position complement(866066..866302) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system