Escherichia ruysiae: OSH18_16675 Help Entry OSH18_16675       CDS       T09019                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eruy  Escherichia ruysiae Pathway eruy01100   Metabolic pathways eruy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eruy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     OSH18_16675    00074 Mycolic acid biosynthesis     OSH18_16675   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     OSH18_16675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 BH4 Motif Other DBs NCBI-ProteinID:  WGM51849 LinkDB All DBs Position complement(3493303..3493551) Genome browser AA seq 82 aa AA seqDB search MVNREIVMDYILSCLQDLVENGVEIKPDSDLVNDLGLESIKVMDLLMMLEDRFDISIPIN ILLDVKTPAQLMETLLPWLENK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggtaaatcgtgaaatagtaatggattacatcctttcctgtttacaggatttggtcgaa aacggtgtggaaattaagcccgacagcgatctcgtcaacgatcttggcctggagtcgatc aaggtgatggatctcttaatgatgctggaagacagattcgatatttccattcctattaat attctgctggatgtcaaaacccctgcgcaattaatggaaacactacttccatggctggag aataaataa

DBGET integrated database retrieval system