KEGG   Erwinia sp. E602: GKQ23_02985
Entry
GKQ23_02985       CDS       T10706                                 
Symbol
tauD
Name
(GenBank) taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
erwe  Erwinia sp. E602
Pathway
erwe00430  Taurine and hypotaurine metabolism
erwe00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:erwe00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    GKQ23_02985 (tauD)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    GKQ23_02985 (tauD)
Enzymes [BR:erwe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     GKQ23_02985 (tauD)
SSDB
Motif
Pfam: TauD DUF1153
Other DBs
NCBI-ProteinID: QUG74036
LinkDB
Position
364089..364928
AA seq 279 aa
MNERIKIEALGPYIGALVSNVDLTRPLSDGQFEQLYHALIRHQVLFLRDQHVTPQQQRQL
ALRFGDLHIHPVYPHAPGVEEIIVLDTHDNNPPDNDNWHTDVTFIETPPAGAILAAKQLP
ETGGDTLWASGIAAFDALSEPLQTLLSGLLAEHDFRKAFQEYKYRGSEEEHQRWQQAVAK
NPPVVHPAIRTHPVSGRKALFVNEGFTTRLVGVKEKESDALLNFLFAHITKPDFQVRWRW
QVGDVAIWDNRVTQHYANADYLPARRIMHRATILGDKPF
NT seq 840 nt   +upstreamnt  +downstreamnt
atgaacgaacgtattaaaattgaagcgctggggccttatatcggcgcgctggtgagcaat
gtcgatctgacccgcccgctgagcgacggccagtttgagcagctctatcacgcgctgatc
cgccatcaggtgctgttcctgcgcgaccagcatgtgacgccgcagcagcagcgccagctg
gcgctgcgcttcggtgatttgcatatccacccggtctacccgcatgcgccgggcgtggaa
gagattatcgtgctggatacccacgacaataatccgccggacaacgacaactggcatacc
gacgtgacctttattgaaacgccgccggccggggcgatccttgccgccaaacagctgccg
gaaaccggcggcgatacgctgtgggccagcggtatcgcggcgtttgatgcgctgtctgag
ccgctgcaaaccctgctcagcggcctgctggccgagcacgatttccgtaaggcgtttcag
gagtataaatatcgcggcagcgaagaggagcatcagcgctggcagcaggcggtggcgaag
aacccgccggtggtgcatccggcgatccgtacccacccggtgagcggcagaaaggcgctg
ttcgtcaacgaaggttttaccacgcggctggtgggcgtgaaggagaaggagagtgacgcg
ctgctgaacttcctgttcgcacacatcaccaaaccggacttccaggtgcgctggcgctgg
caggtgggcgacgtggcgatctgggataaccgggtgacgcagcactatgccaatgcggac
tatctgccggcgcgcaggatcatgcaccgggccaccatcctcggcgacaaacccttctaa

DBGET integrated database retrieval system