Erwinia sorbitola: GN242_15190 Help Entry GN242_15190       CDS       T06366                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism erwi  Erwinia sorbitola Pathway erwi01100   Metabolic pathways erwi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:erwi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GN242_15190    00074 Mycolic acid biosynthesis     GN242_15190   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GN242_15190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QGU88479 UniProt:  A0A6I6ETS4 LinkDB All DBs Position 3359819..3360076 Genome browser AA seq 85 aa AA seqDB search MDQSSLKEKINQVLLQEFELEPGDMVSEALLYEDLGLDSLDAVDMVVSFEKAFAINIGKN TELVSIKTLGELQEFIIRIIAAQHG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggatcaaagttctctgaaagaaaaaatcaatcaggttcttttacaggaatttgaactg gaacctggcgatatggttagcgaagcccttctctacgaagatctcggtctggacagcctg gacgcggtggatatggtggtgagttttgaaaaagcatttgcgataaacatagggaaaaat actgaactggtatcgataaaaacgctcggagagctccaggaatttattatccgcattatt gcagcacaacacggctga

DBGET integrated database retrieval system