KEGG   Erythrobacter sp. SDW2: LY632_08505
Entry
LY632_08505       CDS       T10668                                 
Name
(GenBank) sigma-54 dependent transcriptional regulator
  KO
K07712  two-component system, NtrC family, nitrogen regulation response regulator GlnG
Organism
erys  Erythrobacter sp. SDW2
Pathway
erys02020  Two-component system
Brite
KEGG Orthology (KO) [BR:erys00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LY632_08505
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:erys02022]
    LY632_08505
Two-component system [BR:erys02022]
 NtrC family
  GlnL-GlnG (nitrogen regulation)
   LY632_08505
SSDB
Motif
Pfam: Sigma54_activat Sigma54_activ_2 Response_reg HTH_8 AAA_5 AAA_16 AAA AAA_2 Mg_chelatase HTH_30 TIP49 FleQ AAA_3
Other DBs
NCBI-ProteinID: UIP05751
LinkDB
Position
1739252..1740664
AA seq 470 aa
MTDPILLVEDDNSIAAVIVSALEGEGYAVDRCAAIAARDRLLATQRYACMLTDVMLEDGD
GIATLGKVRGSHPAMPIIILSAQNTLDTAVRASENDAFEYFPKPFDLDELIRAVRQAAGA
SSGNVAEGQPDAGNLPLVGRSQAMQGVFRMITRVLRNDLTVLVLGESGTGKELVAEAIHE
LGARKTGPFVAVNAAAIPRDLIESELFGHEKGAFTGAVGQAIGKFEQANGGTLFLDEIGD
MPLEAQTRLLRALQSGRIRRVGGRQDVAVDVRIIAATNRDLAPMIASGRFREDLFYRLNV
VPIELPPLRARREDIGALARHFLVLAEGEGLPRRQIDEAAVSLLEQQPWRGNVRELRNLI
YRLALLARNEVIDVELAREVLGKEQGHSATERSSSVDRAVMDWIEQHHPAPGALYRAASA
AFEKPLFEHALRVTAGNQLRAAELLGINRNTLRKRLGELGIVAEAFSARA
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgaccgatccgatcctgctggtcgaggatgacaattccatcgctgcggtgattgtaagt
gcgctcgagggtgagggctatgccgtcgaccgttgtgccgcgattgccgcgcgcgaccga
ttgctggccacgcagcgctatgcctgcatgctcaccgatgtgatgctggaagatggcgac
ggcatcgccaccctgggcaaggtgcgtggatcgcatccggcgatgccgatcatcatcctc
tcggcccagaatacgctcgataccgccgtgcgggcgagcgagaacgatgcgttcgaatat
ttccccaagccgttcgacctcgacgagttgatccgggctgtacgccaggcggcgggcgca
tcgtccggtaatgtggccgaaggccagcccgatgccggcaacctgccgctggtcggtcgc
agccaggcgatgcagggtgtgttccgcatgatcacccgcgtgctccgcaacgatctgacg
gtgctggtgctgggcgaatccggcacgggcaaggagctggtggccgaagccatccacgag
ctcggtgcgcgcaagaccgggcctttcgtggccgtgaacgcggccgcgattccgcgtgac
ttgatcgaaagcgaactcttcgggcacgagaaaggcgctttcaccggtgcagtcggccaa
gccattggcaagttcgaacaggccaatggcggcacgctgttcctcgacgaaatcggcgac
atgccgctggaagcgcagacccggctgctgcgggcgttgcagtcggggcgcatccggcgc
gtcggcgggcggcaggatgttgcggtggatgtccgcatcatcgctgccaccaatcgcgac
cttgccccgatgatcgccagcggccggttccgcgaagacctgttctatcgcctcaatgtc
gtccccatcgaactgccgccactgcgggcccggcgcgaggatatcggtgccttggcacgc
catttccttgttcttgcggaaggggaagggctgccccgccgccagatcgatgaagccgca
gtatccttgctcgagcaacagccttggcgcggcaatgtgcgcgaactgcgcaacctcatc
taccgtcttgcgctccttgccaggaacgaggtgatcgacgtcgaattagcccgcgaagtg
ctgggcaaggaacaggggcattctgcgaccgagcgatcctcttcggtcgacagggcagtg
atggattggatcgagcagcaccatccggctccgggcgcgctttatcgtgctgcctccgcc
gcgttcgagaagccgttgttcgaacatgccctgcgcgtcacagccggcaaccagctacgc
gcggccgaattgctcggcatcaaccgcaacacgctgcgcaagcggctcggcgagctcggg
atcgtagccgaagcgttctcggcaagagcctag

DBGET integrated database retrieval system