Erythrobacter sp. 3-20A1M: F7D01_10680
Help
Entry
F7D01_10680 CDS
T10298
Name
(GenBank) ankyrin repeat domain-containing protein
Organism
eryz Erythrobacter sp. 3-20A1M
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ank
Ank_2
Ank_5
Ank_4
Ank_3
Motif
Other DBs
NCBI-ProteinID:
QWC57485
LinkDB
All DBs
Position
complement(2185636..2186391)
Genome browser
AA seq
251 aa
AA seq
DB search
MPRGRERLRRGGSLGKGGAWNRRSVSANWWGRKSGRSAIVDLRSVYKVSQRFLAGFAALL
AVLPLASVGVPAAAQNFSDGYQLLKAVRDADATKASDLLSQPGSTVVNARDRSSGETGLH
IAAKRRDAAWIRFLLQRGANPNLADNKGVSPLMIATRFGDVPSVSALLDGGARINDSDDT
GETPLIVATHLGDPALAKVLLDHGANPDRSDNSGRSARDYARLDDNRRLLEAFAAHDASA
SGNTETYGPSL
NT seq
756 nt
NT seq
+upstream
nt +downstream
nt
atgccgcgaggaagagagagattgcggcgaggaggatcattgggaaagggcggggcatgg
aatcgacgttcagtctctgctaactggtggggtcggaagagcgggcgatccgccatagtc
gatttacggagtgtatataaggtgtcgcagcgctttctcgccggttttgccgccctgctg
gccgttctcccccttgcctcggtcggcgtgccggcagcggcccagaacttttccgatggc
taccagttgctgaaagcggtgcgcgatgccgacgcgacgaaggcgagcgatttgctttcc
cagcccggctccaccgtcgtcaacgctcgcgaccgttccagcggagaaaccggactgcat
atcgcggcgaagcgccgggatgcggcctggatccgtttcctcttgcagcgcggcgcaaat
ccgaaccttgcggataacaagggggtaagccccttgatgatcgcgacccgcttcggcgac
gtgcctagcgtgtcggccctgctcgatggcggcgcgcggatcaatgatagcgacgatacc
ggcgaaaccccgctgatcgtggcaacccatctgggagacccggcgttggcaaaggtgttg
ctcgaccacggggccaatcccgaccgatccgacaattcgggccgcagcgcccgcgattac
gcccggctggacgacaaccgccgcctgctggaagctttcgcggcgcacgatgcgagcgcc
tccggcaataccgagacctatgggccgagcctgtga
DBGET
integrated database retrieval system