Enterobacter lignolyticus SCF1: Entcl_2699 Help Entry Entcl_2699        CDS       T01342                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism esc  Enterobacter lignolyticus SCF1 Pathway esc01100   Metabolic pathways esc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:esc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Entcl_2699    00074 Mycolic acid biosynthesis     Entcl_2699   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Entcl_2699 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  ADO48947 UniProt:  E3GC61 LinkDB All DBs Position complement(2853196..2853432) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgagcagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaggacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system