Enterobacter lignolyticus SCF1: Entcl_3087 Help Entry Entcl_3087        CDS       T01342                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism esc  Enterobacter lignolyticus SCF1 Pathway esc00190   Oxidative phosphorylation esc01100   Metabolic pathways esc02020   Two-component system Module esc_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:esc00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Entcl_3087  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Entcl_3087 Enzymes [BR:esc01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      Entcl_3087 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ADO49333 UniProt:  E3G3S7 LinkDB All DBs Position complement(3288696..3288809) Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACAFGVITALALEHIEASKAGQEEH NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggattttgggaacgcttcttgcctgtgcctttggggtcatcacc gcgctggcgctggaacatattgaagcgtccaaagccggacaagaagagcactga

DBGET integrated database retrieval system