Candidatus Electrothrix scaldis: SD837_03700 Help Entry SD837_03700       CDS       T11025                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism esd  Candidatus Electrothrix scaldis Pathway esd00998   Biosynthesis of various antibiotics esd01100   Metabolic pathways esd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:esd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SD837_03700 (acpP)    00074 Mycolic acid biosynthesis     SD837_03700 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SD837_03700 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  WPD23666 LinkDB All DBs Position 834255..834488 Genome browser AA seq 77 aa AA seqDB search MAVSEKMIDIIEEQLSVDKDKIVPGAAFVDDLGADSLDLVELIMAMEEEFDVEIPDEDAE KIATVQDAIDYVDKIQG NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagtctcagagaaaatgatcgacattattgaagagcaactcagtgttgataaggat aaaatcgttcccggtgcagcttttgtagatgaccttggagcggattcccttgatctggtc gaactgattatggctatggaagaagagtttgatgttgagattcctgatgaggatgcagag aagattgcaactgttcaggatgcgatagactacgttgataagatccagggataa

DBGET integrated database retrieval system