Candidatus Electrothrix scaldis: SD837_04375 Help Entry SD837_04375       CDS       T11025                                  Name (GenBank) HU family DNA-binding protein   KO K05788   integration host factor subunit beta Organism esd  Candidatus Electrothrix scaldis Brite KEGG Orthology (KO) [BR:esd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:esd03032]     SD837_04375    03036 Chromosome and associated proteins [BR:esd03036]     SD837_04375    03400 DNA repair and recombination proteins [BR:esd03400]     SD837_04375 DNA replication proteins [BR:esd03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     SD837_04375 Chromosome and associated proteins [BR:esd03036]  Prokaryotic type   Nucleoid associated proteins    IHF (integration host factor)     SD837_04375 DNA repair and recombination proteins [BR:esd03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       SD837_04375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_1 YtxC Motif Other DBs NCBI-ProteinID:  WPD23797 LinkDB All DBs Position complement(977431..977733) Genome browser AA seq 100 aa AA seqDB search MNKSELIEALAEKIELPVRETAAITKTIIDAMSNALVEGDSIEIRGFGSFTVKQYGAYTG RNPKSGEKINVAPKKLPFFKVGKDLRERVDSEARSQDEEK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgaataaatcggaacttatagaggcattagccgagaaaatcgagctgcccgtacgcgaa actgctgctatcaccaagaccatcattgatgcaatgagcaatgccttggttgagggcgat tctattgaaatccgtggattcggaagttttacagtcaagcagtacggtgcctatacaggc cgcaacccgaaatcaggagaaaaaattaacgttgctccgaaaaagctccccttcttcaag gtgggcaaagatctgagagaacgggtggattctgaagcaagaagccaggacgaagaaaaa taa

DBGET integrated database retrieval system