Escherichia sp. F1: ACK8NJ_15975
Help
Entry
ACK8NJ_15975 CDS
T11101
Symbol
moaE
Name
(GenBank) molybdopterin synthase catalytic subunit MoaE
KO
K03635
molybdopterin synthase catalytic subunit [EC:
2.8.1.12
]
Organism
esf Escherichia sp. F1
Pathway
esf00790
Folate biosynthesis
esf01100
Metabolic pathways
esf01240
Biosynthesis of cofactors
esf04122
Sulfur relay system
Module
esf_M00880
Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:
esf00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00790 Folate biosynthesis
ACK8NJ_15975 (moaE)
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04122 Sulfur relay system
ACK8NJ_15975 (moaE)
Enzymes [BR:
esf01000
]
2. Transferases
2.8 Transferring sulfur-containing groups
2.8.1 Sulfurtransferases
2.8.1.12 molybdopterin synthase
ACK8NJ_15975 (moaE)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MoaE
Motif
Other DBs
NCBI-ProteinID:
XMR19705
LinkDB
All DBs
Position
complement(3288051..3288503)
Genome browser
AA seq
150 aa
AA seq
DB search
MAETKIVVGLQPFSVGEEYPWLAECDEDGAVVTFTGKVRNHNLGDSVKALTLEHYPGMTE
KALAEIVDEARNRWPLGRVTVIHRIGELWPGDEIVFVGVTSAHRSSAFEAGQFIMDYLKT
RAPFWKREATPEGDRWVEARESDQQAAKRW
NT seq
453 nt
NT seq
+upstream
nt +downstream
nt
atggcagaaaccaaaattgttgtcggcctgcagccgttcagtgtaggtgaagagtacccg
tggctggctgagtgtgacgaagacggtgcggtagtcacctttaccggtaaggtgcgcaac
cataaccttggtgacagcgtcaaagcattaaccctcgaacactatccggggatgactgaa
aaagcactggcagaaattgtcgatgaagcgcgtaaccgctggccgctggggcgcgtcaca
gtgattcaccgcatcggggaattatggccgggagatgaaatcgtttttgtcggtgtcacc
agtgcgcatcgcagcagtgcgtttgaagccgggcagtttattatggattatctcaaaacc
cgcgcaccgttctggaagcgtgaagccacgccggaaggcgaccgctgggttgaagctcgg
gagagcgatcagcaggcggcaaaacgctggtag
DBGET
integrated database retrieval system