Enterobacter sichuanensis: C1N69_08715 Help Entry C1N69_08715       CDS       T06532                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism esh  Enterobacter sichuanensis Pathway esh01100   Metabolic pathways esh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:esh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C1N69_08715   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C1N69_08715 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1896 HLH Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  QFQ08771 LinkDB All DBs Position 1813062..1813298 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttgtgaactccgcttccttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaagatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system