Euwallacea similis: 136411380 Help Entry 136411380         CDS       T10684                                  Symbol Rac1 Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism esim  Euwallacea similis Pathway esim04013   MAPK signaling pathway - fly esim04145   Phagosome esim04148   Efferocytosis esim04310   Wnt signaling pathway esim04620   Toll-like receptor signaling pathway esim05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:esim00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     136411380 (Rac1)    04310 Wnt signaling pathway     136411380 (Rac1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     136411380 (Rac1)    04148 Efferocytosis     136411380 (Rac1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     136411380 (Rac1)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     136411380 (Rac1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:esim04131]     136411380 (Rac1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:esim04147]     136411380 (Rac1)    04031 GTP-binding proteins [BR:esim04031]     136411380 (Rac1) Membrane trafficking [BR:esim04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     136411380 (Rac1)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     136411380 (Rac1)   Macropinocytosis    Ras GTPases     136411380 (Rac1)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     136411380 (Rac1) Exosome [BR:esim04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136411380 (Rac1)   Exosomal proteins of other body fluids (saliva and urine)    136411380 (Rac1)   Exosomal proteins of colorectal cancer cells    136411380 (Rac1)   Exosomal proteins of bladder cancer cells    136411380 (Rac1) GTP-binding proteins [BR:esim04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     136411380 (Rac1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  136411380 NCBI-ProteinID:  XP_066250019 LinkDB All DBs Position 10:4331173..4333519 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR EDKSTIEKLKDKKLAPITYPQGLAMAKEISAVKYLECSALTQKGLKTVFDEAIRAVLCPV MPPKPKRKCTLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgataaagtgtgttgtcgtcggagatggtgcggtgggtaaaacatgcctccta atatcctacacaacaaatgcattccctggggaatacatacctacagtgtttgacaactac tctgcgaatgttatggtggatggcaagcctataaacctgggtttatgggacactgcaggt caggaggactacgacaggctgcgccctctgtcttaccctcaaaccgatgtgtttcttata tgcttttctttggtcaatcctgcctcatttgaaaatgtcagggctaaatggtaccctgag gtacggcaccactgccccaacactccaatcattttagtgggcacaaagttggatttaaga gaagacaaaagcaccattgagaaattgaaggataaaaagttagccccaattacttaccct cagggcttggctatggcaaaggagataagtgcagttaaatacttggaatgttcagccctc acacaaaaagggctgaaaacagtgtttgatgaagcaattagagcagtactgtgccctgta atgccacccaaacctaagcgcaagtgcacactgctctaa

DBGET integrated database retrieval system