Escherichia coli O104 H4 2009EL-2050 (EAEC): O3M_23265
Help
Entry
O3M_23265 CDS
T02316
Name
(GenBank) phosphonate/organophosphate ester transporter subunit
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
esm
Escherichia coli O104:H4 2009EL-2050 (EAEC)
Pathway
esm02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
esm00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
O3M_23265
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
esm02000
]
O3M_23265
Enzymes [BR:
esm01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
O3M_23265
Transporters [BR:
esm02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
O3M_23265
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
AAA_29
AAA_16
RsgA_GTPase
SMC_N
AAA_23
nSTAND1
NACHT
AAA_25
AAA_5
AAA_22
AAA_18
Mg_chelatase
ORC-CDC6-like
AAA_30
PRK
MMR_HSR1
AAA_28
AAA_33
nSTAND3
T2SSE
PhoH
Rad17
AAA_24
SbcC_Walker_B
bpMoxR
AAA_7
AAA_19
cobW
TsaE
AAA_14
Motif
Other DBs
NCBI-ProteinID:
AFS59300
LinkDB
All DBs
Position
4802003..4802791
Genome browser
AA seq
262 aa
AA seq
DB search
MQTIIRVEKLAKTFNQHQALHAVDLNIHHGEMVALLGPSGSGKSTLLRHLSGLITGDKSA
GSHIELLGRTVQREGRLARDIRKSRANTGYIFQQFNLVNRLSVLENVLIGALGSTPFWRT
CFSWFTGEQKQRALQALTRVGMVHFAHQRVSTLSGGQQQRVAIARALMQQAKVILADEPI
ASLDPESARIVMDTLRDINQNDGITVVVTLHQVDYALRYCERIVALRQGHVFYDGSSQQF
DNERFDHLYRSINRIEENAKAA
NT seq
789 nt
NT seq
+upstream
nt +downstream
nt
atgcaaacgattatccgtgtcgagaagctcgccaaaaccttcaatcagcatcaggcgctg
catgcggttgatctgaacattcatcacggtgaaatggtggctctgcttgggccgtcgggt
tccggcaaatccacccttttacgtcacttaagcggtttgattaccggcgataaatccgcc
ggcagccatatcgagctgctgggccgcacagtccagcgcgaaggccgtctggcgcgcgat
atccgcaaaagccgcgccaacaccggctacatcttccaacaattcaacctggtgaaccgc
ctgagcgtactggagaacgtgctgattggcgcgctcggcagcacgccgttctggcgcacc
tgttttagctggttcaccggcgagcagaaacagcgcgcgttacaggcgctgacccgcgtt
ggcatggtgcattttgcccatcagcgcgtttccaccctctccggcggacagcagcagcgt
gtggcgattgcccgcgcgctgatgcagcaggcgaaggtgattctggccgatgaacccatc
gcctcgctggacccggaatccgcccgcatcgtgatggacaccctgcgcgacatcaatcag
aacgacggcatcaccgtggtcgtcacgctgcatcaggtggattacgccctgcgctactgc
gaacgcatcgtcgccctgcgccaggggcacgttttctacgacggcagcagccaacagttt
gataacgaacgttttgaccatctctaccgcagcattaatcgcatcgaagagaacgcgaaa
gctgcctga
DBGET
integrated database retrieval system