KEGG   Escherichia coli O104 H4 2009EL-2050 (EAEC): O3M_23265
Entry
O3M_23265         CDS       T02316                                 
Name
(GenBank) phosphonate/organophosphate ester transporter subunit
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
esm  Escherichia coli O104:H4 2009EL-2050 (EAEC)
Pathway
esm02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:esm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    O3M_23265
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:esm02000]
    O3M_23265
Enzymes [BR:esm01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     O3M_23265
Transporters [BR:esm02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    O3M_23265
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_16 RsgA_GTPase SMC_N AAA_23 nSTAND1 NACHT AAA_25 AAA_5 AAA_22 AAA_18 Mg_chelatase ORC-CDC6-like AAA_30 PRK MMR_HSR1 AAA_28 AAA_33 nSTAND3 T2SSE PhoH Rad17 AAA_24 SbcC_Walker_B bpMoxR AAA_7 AAA_19 cobW TsaE AAA_14
Other DBs
NCBI-ProteinID: AFS59300
LinkDB
Position
4802003..4802791
AA seq 262 aa
MQTIIRVEKLAKTFNQHQALHAVDLNIHHGEMVALLGPSGSGKSTLLRHLSGLITGDKSA
GSHIELLGRTVQREGRLARDIRKSRANTGYIFQQFNLVNRLSVLENVLIGALGSTPFWRT
CFSWFTGEQKQRALQALTRVGMVHFAHQRVSTLSGGQQQRVAIARALMQQAKVILADEPI
ASLDPESARIVMDTLRDINQNDGITVVVTLHQVDYALRYCERIVALRQGHVFYDGSSQQF
DNERFDHLYRSINRIEENAKAA
NT seq 789 nt   +upstreamnt  +downstreamnt
atgcaaacgattatccgtgtcgagaagctcgccaaaaccttcaatcagcatcaggcgctg
catgcggttgatctgaacattcatcacggtgaaatggtggctctgcttgggccgtcgggt
tccggcaaatccacccttttacgtcacttaagcggtttgattaccggcgataaatccgcc
ggcagccatatcgagctgctgggccgcacagtccagcgcgaaggccgtctggcgcgcgat
atccgcaaaagccgcgccaacaccggctacatcttccaacaattcaacctggtgaaccgc
ctgagcgtactggagaacgtgctgattggcgcgctcggcagcacgccgttctggcgcacc
tgttttagctggttcaccggcgagcagaaacagcgcgcgttacaggcgctgacccgcgtt
ggcatggtgcattttgcccatcagcgcgtttccaccctctccggcggacagcagcagcgt
gtggcgattgcccgcgcgctgatgcagcaggcgaaggtgattctggccgatgaacccatc
gcctcgctggacccggaatccgcccgcatcgtgatggacaccctgcgcgacatcaatcag
aacgacggcatcaccgtggtcgtcacgctgcatcaggtggattacgccctgcgctactgc
gaacgcatcgtcgccctgcgccaggggcacgttttctacgacggcagcagccaacagttt
gataacgaacgttttgaccatctctaccgcagcattaatcgcatcgaagagaacgcgaaa
gctgcctga

DBGET integrated database retrieval system