Eriocheir sinensis (Chinese mitten crab): 126996612
Help
Entry
126996612 CDS
T08870
Name
(RefSeq) peptidyl-tRNA hydrolase 2, mitochondrial-like
KO
K04794
peptidyl-tRNA hydrolase, PTH2 family [EC:
3.1.1.29
]
Organism
esn
Eriocheir sinensis (Chinese mitten crab)
Brite
KEGG Orthology (KO) [BR:
esn00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03012 Translation factors [BR:
esn03012
]
126996612
Enzymes [BR:
esn01000
]
3. Hydrolases
3.1 Acting on ester bonds
3.1.1 Carboxylic-ester hydrolases
3.1.1.29 peptidyl-tRNA hydrolase
126996612
Translation factors [BR:
esn03012
]
Eukaryotic type
Release factors
126996612
Prokaryotic type
126996612
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
PTH2
Tail_tube
Motif
Other DBs
NCBI-GeneID:
126996612
NCBI-ProteinID:
XP_050713237
LinkDB
All DBs
Position
10:complement(13789450..13795293)
Genome browser
AA seq
184 aa
AA seq
DB search
MIPMVSELLCQPGVMVGVGLGMCIGFFARGSFLSDNESMDPQDSGGGASDDSDDEGWDED
GFLAEGSGEMKLVLVVRSDLKMGKGKAAAQCSHATLKAYKQLQKKNKNILRAWEMNGQPK
VVVKIEDEASMLELSSLAREVGLTVSIIQDAGRTQIAAGSRTVVGIGPGPVDLIDQVTGH
LKLF
NT seq
555 nt
NT seq
+upstream
nt +downstream
nt
atgattcccatggtttccgagttgctttgccagcctggcgtcatggtgggcgtggggctg
ggcatgtgcataggatttttcgcccggggttcctttttaagtgacaacgagagcatggac
cctcaggacagtgggggcggcgcctcagacgactccgatgacgagggctgggacgaggat
ggatttctagctgaagggtccggtgagatgaagcttgtccttgtggtgcgcagtgacctc
aagatggggaagggcaaggcagctgctcagtgctcccatgcaaccctgaaagcctacaaa
cagttgcagaaaaagaacaagaatatcctgagagcttgggagatgaacggccaacccaag
gttgtggtgaagatagaggatgaagcctcgatgctggagctctcatccctagcccgggag
gtgggcctgacagtgagcataattcaggacgccggccgcacccagatcgccgctggttct
cggacagtggttggcatcggtcccggccctgttgacttgatagaccaagtgactggacac
ctgaagctcttctaa
DBGET
integrated database retrieval system