Eriocheir sinensis (Chinese mitten crab): 127009703
Help
Entry
127009703 CDS
T08870
Name
(RefSeq) S-phase kinase-associated protein 1 isoform X1
KO
K03094
S-phase kinase-associated protein 1
Organism
esn
Eriocheir sinensis (Chinese mitten crab)
Pathway
esn03083
Polycomb repressive complex
esn04120
Ubiquitin mediated proteolysis
esn04141
Protein processing in endoplasmic reticulum
esn04310
Wnt signaling pathway
esn04350
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:
esn00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
127009703
04120 Ubiquitin mediated proteolysis
127009703
09126 Chromosome
03083 Polycomb repressive complex
127009703
09130 Environmental Information Processing
09132 Signal transduction
04310 Wnt signaling pathway
127009703
04350 TGF-beta signaling pathway
127009703
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
esn04131
]
127009703
04121 Ubiquitin system [BR:
esn04121
]
127009703
03036 Chromosome and associated proteins [BR:
esn03036
]
127009703
Membrane trafficking [BR:
esn04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
127009703
Ubiquitin system [BR:
esn04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
127009703
Cul7 complex
127009703
Chromosome and associated proteins [BR:
esn03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
127009703
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
127009703
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
Motif
Other DBs
NCBI-GeneID:
127009703
NCBI-ProteinID:
XP_050738997
LinkDB
All DBs
Position
41:14374400..14384657
Genome browser
AA seq
172 aa
AA seq
DB search
MDQLLIDTYQMPSIKLQSSDGDTFDVDVEIAKQSVTIKTMLEDLGMDEDEEEVVPLPNVN
AAILKKVIQWCTYHKDDPPLPDDDDNKEKRTDDISSWDADFLKVDQGTLFELILAANYLD
IKGLLDVTCKTVANMIKGKTPDEIRKTFNIKNDFTPSEEEQVRKENEWCEEK
NT seq
519 nt
NT seq
+upstream
nt +downstream
nt
atggatcaacttttgattgatacataccagatgccgagtatcaaacttcagagcagtgat
ggtgacacatttgacgtggatgtggagatcgccaaacaaagtgtcaccataaaaaccatg
ttagaagatcttggcatggatgaagatgaggaggaggtggttcctctacccaatgtgaat
gcagctatcttgaaaaaggtaatccagtggtgtacctaccataaggatgatccacctctc
cctgatgatgatgacaataaagagaaacgcacagatgatatctcctcttgggatgcagac
ttcttaaaggtggaccagggcacactgtttgaactcatcttggctgccaattacctggac
atcaagggacttctggatgtcacatgcaaaactgtggccaacatgatcaaagggaagact
cctgatgaaatccgcaagacattcaacattaaaaatgactttacaccttcagaagaggag
caagttcgcaaagaaaatgagtggtgtgaagaaaagtaa
DBGET
integrated database retrieval system