Enterococcus saccharolyticus: ACMHDP_01255 Help Entry ACMHDP_01255      CDS       T11148                                  Name (GenBank) 2-hydroxymuconate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism esy  Enterococcus saccharolyticus Pathway esy00362   Benzoate degradation esy00622   Xylene degradation esy01100   Metabolic pathways esy01120   Microbial metabolism in diverse environments esy01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:esy00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     ACMHDP_01255    00622 Xylene degradation     ACMHDP_01255    00621 Dioxin degradation     ACMHDP_01255 Enzymes [BR:esy01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      ACMHDP_01255 SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  XOE04867 LinkDB All DBs Position 241783..241959 Genome browser AA seq 58 aa AA seqDB search MPFVHIELLEGRTPEQLEAMMKEVTDAVHKTSGAPKENIHVIINEMKKGTYGNNGAWK NT seq 177 nt NT seq  +upstreamnt  +downstreamnt atgccatttgtccatattgaattgttagaaggaagaacacctgaacaacttgaagcaatg atgaaagaagtaactgatgctgtgcataaaactagcggagcaccgaaagaaaatattcat gtaattattaatgaaatgaaaaaaggtacttacggaaacaacggcgcttggaaataa

DBGET integrated database retrieval system