Escherichia sp. E4742: FEM44_20295 Help Entry FEM44_20295       CDS       T06276                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism esz  Escherichia sp. E4742 Pathway esz01100   Metabolic pathways esz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:esz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FEM44_20295 (acpP)    00074 Mycolic acid biosynthesis     FEM44_20295 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FEM44_20295 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  QCT89357 LinkDB All DBs Position 4211465..4211701 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system