Eleftheria terrae: N7L95_00795
Help
Entry
N7L95_00795 CDS
T09184
Symbol
truB
Name
(GenBank) tRNA pseudouridine(55) synthase TruB
KO
K03177
tRNA pseudouridine55 synthase [EC:
5.4.99.25
]
Organism
etb
Eleftheria terrae
Brite
KEGG Orthology (KO) [BR:
etb00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03016 Transfer RNA biogenesis [BR:
etb03016
]
N7L95_00795 (truB)
Enzymes [BR:
etb01000
]
5. Isomerases
5.4 Intramolecular transferases
5.4.99 Transferring other groups
5.4.99.25 tRNA pseudouridine55 synthase
N7L95_00795 (truB)
Transfer RNA biogenesis [BR:
etb03016
]
Eukaryotic type
tRNA modification factors
Psudouridine synthases
N7L95_00795 (truB)
Prokaryotic type
N7L95_00795 (truB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TruB_N
TruB_C_2
TruB-C_2
Motif
Other DBs
NCBI-ProteinID:
WKB52973
LinkDB
All DBs
Position
99305..100273
Genome browser
AA seq
322 aa
AA seq
DB search
MQAETTPIAPVARQRVPRRAVHGVLLLDKPLGLSSNDALQKVKRLLRAEKAGHTGTLDPL
ATGLLPLCFGAATKFSQVSLEADKTYRATLQLGVRTSTGDAEGEVLEQRPVEVVPQQLLQ
ACMRFMGPIQQVPPMYSALKRDGRALYEYARAGIEVEREPREVTIFSIEVLKWQGSSLDI
EVRCSKGTYIRTLAEDIGEALGCGAHLSALRRTGSGPVTLQGARTLAELEAMSEAERDAC
LQPVDALLADWPVLRLEAEDAGRFLSGMRRRTAHADAEQVRVYGPQPAAFLGSGSVRAGE
LISTRLLSPLEVQGLLNAQASQ
NT seq
969 nt
NT seq
+upstream
nt +downstream
nt
gtgcaggccgagaccactcccatcgccccagtcgcccgccagcgcgtgccgcgccgtgcc
gtgcacggcgtgttgctgctggacaagccgctgggcctcagcagcaacgacgcgctgcag
aaggtcaagcgcctgttgcgggcggagaaggccggccataccggcacgctggacccgctg
gccaccggcttgctgccgctgtgcttcggcgcggcgaccaagttctcgcaggtgagcctg
gaggccgacaagacctaccgtgccaccttgcagcttggcgtgcgtaccagcaccggcgac
gccgagggcgaggttttggagcagcgcccggtggaggtggtgccacagcagctgctgcag
gcctgcatgcgcttcatggggcccatccagcaggtgccgccgatgtattcggcactcaag
cgcgatggccgtgccttgtacgagtacgctcgtgccggcatcgaggtggagcgcgagccg
cgcgaggtgacgatcttcagcatcgaggtgctgaaatggcagggcagctcgctcgacatc
gaggtacgctgcagcaagggcacctacatccgcacgctggccgaggacatcggcgaggcg
ctcggctgcggtgcccacctgagcgcgctgcgccgcaccggcagcggcccggtgaccttg
cagggcgcccgtaccctggccgagctggaggcaatgagcgaagccgagcgcgacgcctgc
ctgcagccggtggacgcgctgctggccgactggccggtgctgcgcctggaagccgaggac
gccggccgcttcctgagcggcatgcggcggcgcacggcgcatgccgacgccgagcaggtg
cgcgtgtacggcccgcagccggctgccttcctcggcagcggcagcgtgcgggccggtgaa
ctgatttcaacgcggttgttgagcccgctggaggtccaaggcctcctgaacgctcaagca
tcacagtga
DBGET
integrated database retrieval system