Eleftheria terrae: N7L95_06300 Help Entry N7L95_06300       CDS       T09184                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism etb  Eleftheria terrae Brite KEGG Orthology (KO) [BR:etb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:etb03036]     N7L95_06300 (ftsB) Chromosome and associated proteins [BR:etb03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     N7L95_06300 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC KASH_CCD CENP-H ZapB Motif Other DBs NCBI-ProteinID:  WKB53997 LinkDB All DBs Position 1433803..1434084 Genome browser AA seq 93 aa AA seqDB search MRLPLLTLVLAALLLLVHAELWFGKNGVHRVVELQHKLADHQAKNEVARERNAQLAAEVR DLKEGLEMVEEKARFELGMVKPNEVYVQVSNAP NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgcgcctgccgctgctcaccctggtgctcgccgcgctgctcctgctggtccatgcggag ctgtggttcggcaagaatggcgtgcaccgggtggtggagctgcagcacaagctggccgac caccaggccaagaacgaggtcgcccgcgagcgcaatgcgcagctggcggccgaggttcgc gacctgaaggaaggcctggagatggtcgaggagaaggcccgcttcgagctgggcatggtg aagccgaacgaggtctacgttcaggtttccaacgcgccctga

DBGET integrated database retrieval system