Edwardsiella piscicida C07-087: ETAC_04020 Help Entry ETAC_04020        CDS       T02509                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism etc  Edwardsiella piscicida C07-087 Pathway etc01100   Metabolic pathways etc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:etc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ETAC_04020    00074 Mycolic acid biosynthesis     ETAC_04020   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ETAC_04020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGH72935 LinkDB All DBs Position complement(931572..931829) Genome browser AA seq 85 aa AA seqDB search MQELYLEIKNLIINTLNLDELSTDDIDTDAALFGDGLGLDSIDALELGLAVKNQYGIVLS AESEEMRQHFYSVATLAAFIHSQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagagctttaccttgaaattaaaaatctcattattaacacgttaaatctggacgag ctgagcaccgatgacatcgacaccgatgccgcgctgttcggggatggattaggtctggac tctatcgacgcattagagctgggtctggcggtgaaaaatcagtacggcatcgtcttgtcc gccgaaagtgaagagatgcgtcagcacttctactccgtggcgacgctggccgcttttatt cactcacaacgcgcctga

DBGET integrated database retrieval system